@charset "UTF-8";
/* Config */
/* Grid */
/* Break Points */
/* Section Padding */
/* Color */
/* Misc */
/* Vendor */
html {
  box-sizing: border-box; }

*, *::after, *::before {
  box-sizing: inherit; }

/*! normalize.css v3.0.3 | MIT License | github.com/necolas/normalize.css */
/**
 * 1. Set default font family to sans-serif.
 * 2. Prevent iOS and IE text size adjust after device orientation change,
 *    without disabling user zoom.
 */
html {
  font-family: sans-serif;
  /* 1 */
  -ms-text-size-adjust: 100%;
  /* 2 */
  -webkit-text-size-adjust: 100%;
  /* 2 */ }

/**
 * Remove default margin.
 */
body {
  margin: 0; }

/* HTML5 display definitions
   ========================================================================== */
/**
 * Correct `block` display not defined for any HTML5 element in IE 8/9.
 * Correct `block` display not defined for `details` or `summary` in IE 10/11
 * and Firefox.
 * Correct `block` display not defined for `main` in IE 11.
 */
article,
aside,
details,
figcaption,
figure,
footer,
header,
hgroup,
main,
menu,
nav,
section,
summary {
  display: block; }

/**
 * 1. Correct `inline-block` display not defined in IE 8/9.
 * 2. Normalize vertical alignment of `progress` in Chrome, Firefox, and Opera.
 */
audio,
canvas,
progress,
video {
  display: inline-block;
  /* 1 */
  vertical-align: baseline;
  /* 2 */ }

/**
 * Prevent modern browsers from displaying `audio` without controls.
 * Remove excess height in iOS 5 devices.
 */
audio:not([controls]) {
  display: none;
  height: 0; }

/**
 * Address `[hidden]` styling not present in IE 8/9/10.
 * Hide the `template` element in IE 8/9/10/11, Safari, and Firefox < 22.
 */
[hidden],
template {
  display: none; }

/* Links
   ========================================================================== */
/**
 * Remove the gray background color from active links in IE 10.
 */
a {
  background-color: transparent; }

/**
 * Improve readability of focused elements when they are also in an
 * active/hover state.
 */
a:active,
a:hover {
  outline: 0; }

/* Text-level semantics
   ========================================================================== */
/**
 * Address styling not present in IE 8/9/10/11, Safari, and Chrome.
 */
abbr[title] {
  border-bottom: 1px dotted; }

/**
 * Address style set to `bolder` in Firefox 4+, Safari, and Chrome.
 */
b,
strong {
  font-weight: bold; }

/**
 * Address styling not present in Safari and Chrome.
 */
dfn {
  font-style: italic; }

/**
 * Address variable `h1` font-size and margin within `section` and `article`
 * contexts in Firefox 4+, Safari, and Chrome.
 */
h1 {
  font-size: 2em;
  margin: 0.67em 0; }

/**
 * Address styling not present in IE 8/9.
 */
mark {
  background: #ff0;
  color: #000; }

/**
 * Address inconsistent and variable font size in all browsers.
 */
small {
  font-size: 80%; }

/**
 * Prevent `sub` and `sup` affecting `line-height` in all browsers.
 */
sub,
sup {
  font-size: 75%;
  line-height: 0;
  position: relative;
  vertical-align: baseline; }

sup {
  top: -0.5em; }

sub {
  bottom: -0.25em; }

/* Embedded content
   ========================================================================== */
/**
 * Remove border when inside `a` element in IE 8/9/10.
 */
img {
  border: 0; }

/**
 * Correct overflow not hidden in IE 9/10/11.
 */
svg:not(:root) {
  overflow: hidden; }

/* Grouping content
   ========================================================================== */
/**
 * Address margin not present in IE 8/9 and Safari.
 */
figure {
  margin: 1em 40px; }

/**
 * Address differences between Firefox and other browsers.
 */
hr {
  box-sizing: content-box;
  height: 0; }

/**
 * Contain overflow in all browsers.
 */
pre {
  overflow: auto; }

/**
 * Address odd `em`-unit font size rendering in all browsers.
 */
code,
kbd,
pre,
samp {
  font-family: monospace, monospace;
  font-size: 1em; }

/* Forms
   ========================================================================== */
/**
 * Known limitation: by default, Chrome and Safari on OS X allow very limited
 * styling of `select`, unless a `border` property is set.
 */
/**
 * 1. Correct color not being inherited.
 *    Known issue: affects color of disabled elements.
 * 2. Correct font properties not being inherited.
 * 3. Address margins set differently in Firefox 4+, Safari, and Chrome.
 */
button,
input,
optgroup,
select,
textarea {
  color: inherit;
  /* 1 */
  font: inherit;
  /* 2 */
  margin: 0;
  /* 3 */ }

/**
 * Address `overflow` set to `hidden` in IE 8/9/10/11.
 */
button {
  overflow: visible; }

/**
 * Address inconsistent `text-transform` inheritance for `button` and `select`.
 * All other form control elements do not inherit `text-transform` values.
 * Correct `button` style inheritance in Firefox, IE 8/9/10/11, and Opera.
 * Correct `select` style inheritance in Firefox.
 */
button,
select {
  text-transform: none; }

/**
 * 1. Avoid the WebKit bug in Android 4.0.* where (2) destroys native `audio`
 *    and `video` controls.
 * 2. Correct inability to style clickable `input` types in iOS.
 * 3. Improve usability and consistency of cursor style between image-type
 *    `input` and others.
 */
button,
html input[type="button"],
input[type="reset"],
input[type="submit"] {
  -webkit-appearance: button;
  /* 2 */
  cursor: pointer;
  /* 3 */ }

/**
 * Re-set default cursor for disabled elements.
 */
button[disabled],
html input[disabled] {
  cursor: default; }

/**
 * Remove inner padding and border in Firefox 4+.
 */
button::-moz-focus-inner,
input::-moz-focus-inner {
  border: 0;
  padding: 0; }

/**
 * Address Firefox 4+ setting `line-height` on `input` using `!important` in
 * the UA stylesheet.
 */
input {
  line-height: normal; }

/**
 * It's recommended that you don't attempt to style these elements.
 * Firefox's implementation doesn't respect box-sizing, padding, or width.
 *
 * 1. Address box sizing set to `content-box` in IE 8/9/10.
 * 2. Remove excess padding in IE 8/9/10.
 */
input[type="checkbox"],
input[type="radio"] {
  box-sizing: border-box;
  /* 1 */
  padding: 0;
  /* 2 */ }

/**
 * Fix the cursor style for Chrome's increment/decrement buttons. For certain
 * `font-size` values of the `input`, it causes the cursor style of the
 * decrement button to change from `default` to `text`.
 */
input[type="number"]::-webkit-inner-spin-button,
input[type="number"]::-webkit-outer-spin-button {
  height: auto; }

/**
 * 1. Address `appearance` set to `searchfield` in Safari and Chrome.
 * 2. Address `box-sizing` set to `border-box` in Safari and Chrome.
 */
input[type="search"] {
  -webkit-appearance: textfield;
  /* 1 */
  box-sizing: content-box;
  /* 2 */ }

/**
 * Remove inner padding and search cancel button in Safari and Chrome on OS X.
 * Safari (but not Chrome) clips the cancel button when the search input has
 * padding (and `textfield` appearance).
 */
input[type="search"]::-webkit-search-cancel-button,
input[type="search"]::-webkit-search-decoration {
  -webkit-appearance: none; }

/**
 * Define consistent border, margin, and padding.
 */
fieldset {
  border: 1px solid #c0c0c0;
  margin: 0 2px;
  padding: 0.35em 0.625em 0.75em; }

/**
 * 1. Correct `color` not being inherited in IE 8/9/10/11.
 * 2. Remove padding so people aren't caught out if they zero out fieldsets.
 */
legend {
  border: 0;
  /* 1 */
  padding: 0;
  /* 2 */ }

/**
 * Remove default vertical scrollbar in IE 8/9/10/11.
 */
textarea {
  overflow: auto; }

/**
 * Don't inherit the `font-weight` (applied by a rule above).
 * NOTE: the default cannot safely be changed in Chrome and Safari on OS X.
 */
optgroup {
  font-weight: bold; }

/* Tables
   ========================================================================== */
/**
 * Remove most spacing between table cells.
 */
table {
  border-collapse: collapse;
  border-spacing: 0; }

td,
th {
  padding: 0; }

/*!
Animate.css - http://daneden.me/animate
Licensed under the MIT license - http://opensource.org/licenses/MIT

Copyright (c) 2015 Daniel Eden
*/
.animated {
  -webkit-animation-duration: .5s;
  animation-duration: .5s;
  -webkit-animation-fill-mode: both;
  animation-fill-mode: both; }

.animated.infinite {
  -webkit-animation-iteration-count: infinite;
  animation-iteration-count: infinite; }

.animated.hinge {
  -webkit-animation-duration: 2s;
  animation-duration: 2s; }

.animated.bounceIn,
.animated.bounceOut {
  -webkit-animation-duration: .75s;
  animation-duration: .75s; }

.animated.flipOutX,
.animated.flipOutY {
  -webkit-animation-duration: .75s;
  animation-duration: .75s; }

@-webkit-keyframes bounce {
  0%, 20%, 53%, 80%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  40%, 43% {
    -webkit-transition-timing-function: cubic-bezier(0.755, 0.05, 0.855, 0.06);
    transition-timing-function: cubic-bezier(0.755, 0.05, 0.855, 0.06);
    -webkit-transform: translate3d(0, -30px, 0);
    transform: translate3d(0, -30px, 0); }
  70% {
    -webkit-transition-timing-function: cubic-bezier(0.755, 0.05, 0.855, 0.06);
    transition-timing-function: cubic-bezier(0.755, 0.05, 0.855, 0.06);
    -webkit-transform: translate3d(0, -15px, 0);
    transform: translate3d(0, -15px, 0); }
  90% {
    -webkit-transform: translate3d(0, -4px, 0);
    transform: translate3d(0, -4px, 0); } }

@keyframes bounce {
  0%, 20%, 53%, 80%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  40%, 43% {
    -webkit-transition-timing-function: cubic-bezier(0.755, 0.05, 0.855, 0.06);
    transition-timing-function: cubic-bezier(0.755, 0.05, 0.855, 0.06);
    -webkit-transform: translate3d(0, -30px, 0);
    transform: translate3d(0, -30px, 0); }
  70% {
    -webkit-transition-timing-function: cubic-bezier(0.755, 0.05, 0.855, 0.06);
    transition-timing-function: cubic-bezier(0.755, 0.05, 0.855, 0.06);
    -webkit-transform: translate3d(0, -15px, 0);
    transform: translate3d(0, -15px, 0); }
  90% {
    -webkit-transform: translate3d(0, -4px, 0);
    transform: translate3d(0, -4px, 0); } }

.bounce {
  -webkit-animation-name: bounce;
  animation-name: bounce;
  -webkit-transform-origin: center bottom;
  transform-origin: center bottom; }

@-webkit-keyframes flash {
  0%, 50%, 100% {
    opacity: 1; }
  25%, 75% {
    opacity: 0; } }

@keyframes flash {
  0%, 50%, 100% {
    opacity: 1; }
  25%, 75% {
    opacity: 0; } }

/* originally authored by Nick Pettit - https://github.com/nickpettit/glide */
@-webkit-keyframes pulse {
  0% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); }
  50% {
    -webkit-transform: scale3d(1.05, 1.05, 1.05);
    transform: scale3d(1.05, 1.05, 1.05); }
  100% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); } }

@keyframes pulse {
  0% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); }
  50% {
    -webkit-transform: scale3d(1.05, 1.05, 1.05);
    transform: scale3d(1.05, 1.05, 1.05); }
  100% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); } }

.pulse {
  -webkit-animation-name: pulse;
  animation-name: pulse; }

@-webkit-keyframes rubberBand {
  0% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); }
  30% {
    -webkit-transform: scale3d(1.25, 0.75, 1);
    transform: scale3d(1.25, 0.75, 1); }
  40% {
    -webkit-transform: scale3d(0.75, 1.25, 1);
    transform: scale3d(0.75, 1.25, 1); }
  50% {
    -webkit-transform: scale3d(1.15, 0.85, 1);
    transform: scale3d(1.15, 0.85, 1); }
  65% {
    -webkit-transform: scale3d(0.95, 1.05, 1);
    transform: scale3d(0.95, 1.05, 1); }
  75% {
    -webkit-transform: scale3d(1.05, 0.95, 1);
    transform: scale3d(1.05, 0.95, 1); }
  100% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); } }

@keyframes rubberBand {
  0% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); }
  30% {
    -webkit-transform: scale3d(1.25, 0.75, 1);
    transform: scale3d(1.25, 0.75, 1); }
  40% {
    -webkit-transform: scale3d(0.75, 1.25, 1);
    transform: scale3d(0.75, 1.25, 1); }
  50% {
    -webkit-transform: scale3d(1.15, 0.85, 1);
    transform: scale3d(1.15, 0.85, 1); }
  65% {
    -webkit-transform: scale3d(0.95, 1.05, 1);
    transform: scale3d(0.95, 1.05, 1); }
  75% {
    -webkit-transform: scale3d(1.05, 0.95, 1);
    transform: scale3d(1.05, 0.95, 1); }
  100% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); } }

.rubberBand {
  -webkit-animation-name: rubberBand;
  animation-name: rubberBand; }

@-webkit-keyframes shake {
  0%, 100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  10%, 30%, 50%, 70%, 90% {
    -webkit-transform: translate3d(-10px, 0, 0);
    transform: translate3d(-10px, 0, 0); }
  20%, 40%, 60%, 80% {
    -webkit-transform: translate3d(10px, 0, 0);
    transform: translate3d(10px, 0, 0); } }

@keyframes shake {
  0%, 100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  10%, 30%, 50%, 70%, 90% {
    -webkit-transform: translate3d(-10px, 0, 0);
    transform: translate3d(-10px, 0, 0); }
  20%, 40%, 60%, 80% {
    -webkit-transform: translate3d(10px, 0, 0);
    transform: translate3d(10px, 0, 0); } }

.shake {
  -webkit-animation-name: shake;
  animation-name: shake; }

@-webkit-keyframes swing {
  20% {
    -webkit-transform: rotate3d(0, 0, 1, 15deg);
    transform: rotate3d(0, 0, 1, 15deg); }
  40% {
    -webkit-transform: rotate3d(0, 0, 1, -10deg);
    transform: rotate3d(0, 0, 1, -10deg); }
  60% {
    -webkit-transform: rotate3d(0, 0, 1, 5deg);
    transform: rotate3d(0, 0, 1, 5deg); }
  80% {
    -webkit-transform: rotate3d(0, 0, 1, -5deg);
    transform: rotate3d(0, 0, 1, -5deg); }
  100% {
    -webkit-transform: rotate3d(0, 0, 1, 0deg);
    transform: rotate3d(0, 0, 1, 0deg); } }

@keyframes swing {
  20% {
    -webkit-transform: rotate3d(0, 0, 1, 15deg);
    transform: rotate3d(0, 0, 1, 15deg); }
  40% {
    -webkit-transform: rotate3d(0, 0, 1, -10deg);
    transform: rotate3d(0, 0, 1, -10deg); }
  60% {
    -webkit-transform: rotate3d(0, 0, 1, 5deg);
    transform: rotate3d(0, 0, 1, 5deg); }
  80% {
    -webkit-transform: rotate3d(0, 0, 1, -5deg);
    transform: rotate3d(0, 0, 1, -5deg); }
  100% {
    -webkit-transform: rotate3d(0, 0, 1, 0deg);
    transform: rotate3d(0, 0, 1, 0deg); } }

.swing {
  -webkit-transform-origin: top center;
  transform-origin: top center;
  -webkit-animation-name: swing;
  animation-name: swing; }

@-webkit-keyframes tada {
  0% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); }
  10%, 20% {
    -webkit-transform: scale3d(0.9, 0.9, 0.9) rotate3d(0, 0, 1, -3deg);
    transform: scale3d(0.9, 0.9, 0.9) rotate3d(0, 0, 1, -3deg); }
  30%, 50%, 70%, 90% {
    -webkit-transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, 3deg);
    transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, 3deg); }
  40%, 60%, 80% {
    -webkit-transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, -3deg);
    transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, -3deg); }
  100% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); } }

@keyframes tada {
  0% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); }
  10%, 20% {
    -webkit-transform: scale3d(0.9, 0.9, 0.9) rotate3d(0, 0, 1, -3deg);
    transform: scale3d(0.9, 0.9, 0.9) rotate3d(0, 0, 1, -3deg); }
  30%, 50%, 70%, 90% {
    -webkit-transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, 3deg);
    transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, 3deg); }
  40%, 60%, 80% {
    -webkit-transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, -3deg);
    transform: scale3d(1.1, 1.1, 1.1) rotate3d(0, 0, 1, -3deg); }
  100% {
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); } }

.tada {
  -webkit-animation-name: tada;
  animation-name: tada; }

/* originally authored by Nick Pettit - https://github.com/nickpettit/glide */
@-webkit-keyframes wobble {
  0% {
    -webkit-transform: none;
    transform: none; }
  15% {
    -webkit-transform: translate3d(-25%, 0, 0) rotate3d(0, 0, 1, -5deg);
    transform: translate3d(-25%, 0, 0) rotate3d(0, 0, 1, -5deg); }
  30% {
    -webkit-transform: translate3d(20%, 0, 0) rotate3d(0, 0, 1, 3deg);
    transform: translate3d(20%, 0, 0) rotate3d(0, 0, 1, 3deg); }
  45% {
    -webkit-transform: translate3d(-15%, 0, 0) rotate3d(0, 0, 1, -3deg);
    transform: translate3d(-15%, 0, 0) rotate3d(0, 0, 1, -3deg); }
  60% {
    -webkit-transform: translate3d(10%, 0, 0) rotate3d(0, 0, 1, 2deg);
    transform: translate3d(10%, 0, 0) rotate3d(0, 0, 1, 2deg); }
  75% {
    -webkit-transform: translate3d(-5%, 0, 0) rotate3d(0, 0, 1, -1deg);
    transform: translate3d(-5%, 0, 0) rotate3d(0, 0, 1, -1deg); }
  100% {
    -webkit-transform: none;
    transform: none; } }

@keyframes wobble {
  0% {
    -webkit-transform: none;
    transform: none; }
  15% {
    -webkit-transform: translate3d(-25%, 0, 0) rotate3d(0, 0, 1, -5deg);
    transform: translate3d(-25%, 0, 0) rotate3d(0, 0, 1, -5deg); }
  30% {
    -webkit-transform: translate3d(20%, 0, 0) rotate3d(0, 0, 1, 3deg);
    transform: translate3d(20%, 0, 0) rotate3d(0, 0, 1, 3deg); }
  45% {
    -webkit-transform: translate3d(-15%, 0, 0) rotate3d(0, 0, 1, -3deg);
    transform: translate3d(-15%, 0, 0) rotate3d(0, 0, 1, -3deg); }
  60% {
    -webkit-transform: translate3d(10%, 0, 0) rotate3d(0, 0, 1, 2deg);
    transform: translate3d(10%, 0, 0) rotate3d(0, 0, 1, 2deg); }
  75% {
    -webkit-transform: translate3d(-5%, 0, 0) rotate3d(0, 0, 1, -1deg);
    transform: translate3d(-5%, 0, 0) rotate3d(0, 0, 1, -1deg); }
  100% {
    -webkit-transform: none;
    transform: none; } }

.wobble {
  -webkit-animation-name: wobble;
  animation-name: wobble; }

@-webkit-keyframes bounceIn {
  0%, 20%, 40%, 60%, 80%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.3, 0.3, 0.3);
    transform: scale3d(0.3, 0.3, 0.3); }
  20% {
    -webkit-transform: scale3d(1.1, 1.1, 1.1);
    transform: scale3d(1.1, 1.1, 1.1); }
  40% {
    -webkit-transform: scale3d(0.9, 0.9, 0.9);
    transform: scale3d(0.9, 0.9, 0.9); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(1.03, 1.03, 1.03);
    transform: scale3d(1.03, 1.03, 1.03); }
  80% {
    -webkit-transform: scale3d(0.97, 0.97, 0.97);
    transform: scale3d(0.97, 0.97, 0.97); }
  100% {
    opacity: 1;
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); } }

@keyframes bounceIn {
  0%, 20%, 40%, 60%, 80%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.3, 0.3, 0.3);
    transform: scale3d(0.3, 0.3, 0.3); }
  20% {
    -webkit-transform: scale3d(1.1, 1.1, 1.1);
    transform: scale3d(1.1, 1.1, 1.1); }
  40% {
    -webkit-transform: scale3d(0.9, 0.9, 0.9);
    transform: scale3d(0.9, 0.9, 0.9); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(1.03, 1.03, 1.03);
    transform: scale3d(1.03, 1.03, 1.03); }
  80% {
    -webkit-transform: scale3d(0.97, 0.97, 0.97);
    transform: scale3d(0.97, 0.97, 0.97); }
  100% {
    opacity: 1;
    -webkit-transform: scale3d(1, 1, 1);
    transform: scale3d(1, 1, 1); } }

.bounceIn {
  -webkit-animation-name: bounceIn;
  animation-name: bounceIn; }

@-webkit-keyframes bounceInDown {
  0%, 60%, 75%, 90%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, -3000px, 0);
    transform: translate3d(0, -3000px, 0); }
  60% {
    opacity: 1;
    -webkit-transform: translate3d(0, 25px, 0);
    transform: translate3d(0, 25px, 0); }
  75% {
    -webkit-transform: translate3d(0, -10px, 0);
    transform: translate3d(0, -10px, 0); }
  90% {
    -webkit-transform: translate3d(0, 5px, 0);
    transform: translate3d(0, 5px, 0); }
  100% {
    -webkit-transform: none;
    transform: none; } }

@keyframes bounceInDown {
  0%, 60%, 75%, 90%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, -3000px, 0);
    transform: translate3d(0, -3000px, 0); }
  60% {
    opacity: 1;
    -webkit-transform: translate3d(0, 25px, 0);
    transform: translate3d(0, 25px, 0); }
  75% {
    -webkit-transform: translate3d(0, -10px, 0);
    transform: translate3d(0, -10px, 0); }
  90% {
    -webkit-transform: translate3d(0, 5px, 0);
    transform: translate3d(0, 5px, 0); }
  100% {
    -webkit-transform: none;
    transform: none; } }

.bounceInDown {
  -webkit-animation-name: bounceInDown;
  animation-name: bounceInDown; }

@-webkit-keyframes bounceInLeft {
  0%, 60%, 75%, 90%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: translate3d(-3000px, 0, 0);
    transform: translate3d(-3000px, 0, 0); }
  60% {
    opacity: 1;
    -webkit-transform: translate3d(25px, 0, 0);
    transform: translate3d(25px, 0, 0); }
  75% {
    -webkit-transform: translate3d(-10px, 0, 0);
    transform: translate3d(-10px, 0, 0); }
  90% {
    -webkit-transform: translate3d(5px, 0, 0);
    transform: translate3d(5px, 0, 0); }
  100% {
    -webkit-transform: none;
    transform: none; } }

@keyframes bounceInLeft {
  0%, 60%, 75%, 90%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: translate3d(-3000px, 0, 0);
    transform: translate3d(-3000px, 0, 0); }
  60% {
    opacity: 1;
    -webkit-transform: translate3d(25px, 0, 0);
    transform: translate3d(25px, 0, 0); }
  75% {
    -webkit-transform: translate3d(-10px, 0, 0);
    transform: translate3d(-10px, 0, 0); }
  90% {
    -webkit-transform: translate3d(5px, 0, 0);
    transform: translate3d(5px, 0, 0); }
  100% {
    -webkit-transform: none;
    transform: none; } }

.bounceInLeft {
  -webkit-animation-name: bounceInLeft;
  animation-name: bounceInLeft; }

@-webkit-keyframes bounceInRight {
  0%, 60%, 75%, 90%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: translate3d(3000px, 0, 0);
    transform: translate3d(3000px, 0, 0); }
  60% {
    opacity: 1;
    -webkit-transform: translate3d(-25px, 0, 0);
    transform: translate3d(-25px, 0, 0); }
  75% {
    -webkit-transform: translate3d(10px, 0, 0);
    transform: translate3d(10px, 0, 0); }
  90% {
    -webkit-transform: translate3d(-5px, 0, 0);
    transform: translate3d(-5px, 0, 0); }
  100% {
    -webkit-transform: none;
    transform: none; } }

@keyframes bounceInRight {
  0%, 60%, 75%, 90%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: translate3d(3000px, 0, 0);
    transform: translate3d(3000px, 0, 0); }
  60% {
    opacity: 1;
    -webkit-transform: translate3d(-25px, 0, 0);
    transform: translate3d(-25px, 0, 0); }
  75% {
    -webkit-transform: translate3d(10px, 0, 0);
    transform: translate3d(10px, 0, 0); }
  90% {
    -webkit-transform: translate3d(-5px, 0, 0);
    transform: translate3d(-5px, 0, 0); }
  100% {
    -webkit-transform: none;
    transform: none; } }

.bounceInRight {
  -webkit-animation-name: bounceInRight;
  animation-name: bounceInRight; }

@-webkit-keyframes bounceInUp {
  0%, 60%, 75%, 90%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, 3000px, 0);
    transform: translate3d(0, 3000px, 0); }
  60% {
    opacity: 1;
    -webkit-transform: translate3d(0, -20px, 0);
    transform: translate3d(0, -20px, 0); }
  75% {
    -webkit-transform: translate3d(0, 10px, 0);
    transform: translate3d(0, 10px, 0); }
  90% {
    -webkit-transform: translate3d(0, -5px, 0);
    transform: translate3d(0, -5px, 0); }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

@keyframes bounceInUp {
  0%, 60%, 75%, 90%, 100% {
    -webkit-transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1);
    transition-timing-function: cubic-bezier(0.215, 0.61, 0.355, 1); }
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, 3000px, 0);
    transform: translate3d(0, 3000px, 0); }
  60% {
    opacity: 1;
    -webkit-transform: translate3d(0, -20px, 0);
    transform: translate3d(0, -20px, 0); }
  75% {
    -webkit-transform: translate3d(0, 10px, 0);
    transform: translate3d(0, 10px, 0); }
  90% {
    -webkit-transform: translate3d(0, -5px, 0);
    transform: translate3d(0, -5px, 0); }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

.bounceInUp {
  -webkit-animation-name: bounceInUp;
  animation-name: bounceInUp; }

@-webkit-keyframes bounceOut {
  20% {
    -webkit-transform: scale3d(0.9, 0.9, 0.9);
    transform: scale3d(0.9, 0.9, 0.9); }
  50%, 55% {
    opacity: 1;
    -webkit-transform: scale3d(1.1, 1.1, 1.1);
    transform: scale3d(1.1, 1.1, 1.1); }
  100% {
    opacity: 0;
    -webkit-transform: scale3d(0.3, 0.3, 0.3);
    transform: scale3d(0.3, 0.3, 0.3); } }

@keyframes bounceOut {
  20% {
    -webkit-transform: scale3d(0.9, 0.9, 0.9);
    transform: scale3d(0.9, 0.9, 0.9); }
  50%, 55% {
    opacity: 1;
    -webkit-transform: scale3d(1.1, 1.1, 1.1);
    transform: scale3d(1.1, 1.1, 1.1); }
  100% {
    opacity: 0;
    -webkit-transform: scale3d(0.3, 0.3, 0.3);
    transform: scale3d(0.3, 0.3, 0.3); } }

.bounceOut {
  -webkit-animation-name: bounceOut;
  animation-name: bounceOut; }

@-webkit-keyframes bounceOutDown {
  20% {
    -webkit-transform: translate3d(0, 10px, 0);
    transform: translate3d(0, 10px, 0); }
  40%, 45% {
    opacity: 1;
    -webkit-transform: translate3d(0, -20px, 0);
    transform: translate3d(0, -20px, 0); }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, 2000px, 0);
    transform: translate3d(0, 2000px, 0); } }

@keyframes bounceOutDown {
  20% {
    -webkit-transform: translate3d(0, 10px, 0);
    transform: translate3d(0, 10px, 0); }
  40%, 45% {
    opacity: 1;
    -webkit-transform: translate3d(0, -20px, 0);
    transform: translate3d(0, -20px, 0); }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, 2000px, 0);
    transform: translate3d(0, 2000px, 0); } }

.bounceOutDown {
  -webkit-animation-name: bounceOutDown;
  animation-name: bounceOutDown; }

@-webkit-keyframes bounceOutLeft {
  20% {
    opacity: 1;
    -webkit-transform: translate3d(20px, 0, 0);
    transform: translate3d(20px, 0, 0); }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(-2000px, 0, 0);
    transform: translate3d(-2000px, 0, 0); } }

@keyframes bounceOutLeft {
  20% {
    opacity: 1;
    -webkit-transform: translate3d(20px, 0, 0);
    transform: translate3d(20px, 0, 0); }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(-2000px, 0, 0);
    transform: translate3d(-2000px, 0, 0); } }

.bounceOutLeft {
  -webkit-animation-name: bounceOutLeft;
  animation-name: bounceOutLeft; }

@-webkit-keyframes bounceOutRight {
  20% {
    opacity: 1;
    -webkit-transform: translate3d(-20px, 0, 0);
    transform: translate3d(-20px, 0, 0); }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(2000px, 0, 0);
    transform: translate3d(2000px, 0, 0); } }

@keyframes bounceOutRight {
  20% {
    opacity: 1;
    -webkit-transform: translate3d(-20px, 0, 0);
    transform: translate3d(-20px, 0, 0); }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(2000px, 0, 0);
    transform: translate3d(2000px, 0, 0); } }

.bounceOutRight {
  -webkit-animation-name: bounceOutRight;
  animation-name: bounceOutRight; }

@-webkit-keyframes bounceOutUp {
  20% {
    -webkit-transform: translate3d(0, -10px, 0);
    transform: translate3d(0, -10px, 0); }
  40%, 45% {
    opacity: 1;
    -webkit-transform: translate3d(0, 20px, 0);
    transform: translate3d(0, 20px, 0); }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, -2000px, 0);
    transform: translate3d(0, -2000px, 0); } }

@keyframes bounceOutUp {
  20% {
    -webkit-transform: translate3d(0, -10px, 0);
    transform: translate3d(0, -10px, 0); }
  40%, 45% {
    opacity: 1;
    -webkit-transform: translate3d(0, 20px, 0);
    transform: translate3d(0, 20px, 0); }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, -2000px, 0);
    transform: translate3d(0, -2000px, 0); } }

.bounceOutUp {
  -webkit-animation-name: bounceOutUp;
  animation-name: bounceOutUp; }

@-webkit-keyframes fadeIn {
  0% {
    opacity: 0; }
  100% {
    opacity: 1; } }

@keyframes fadeIn {
  0% {
    opacity: 0; }
  100% {
    opacity: 1; } }

.fadeIn {
  -webkit-animation-name: fadeIn;
  animation-name: fadeIn; }

@-webkit-keyframes fadeInDown {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, -100%, 0);
    transform: translate3d(0, -100%, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes fadeInDown {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, -100%, 0);
    transform: translate3d(0, -100%, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.fadeInDown {
  -webkit-animation-name: fadeInDown;
  animation-name: fadeInDown; }

@-webkit-keyframes fadeInDownBig {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, -2000px, 0);
    transform: translate3d(0, -2000px, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes fadeInDownBig {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, -2000px, 0);
    transform: translate3d(0, -2000px, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.fadeInDownBig {
  -webkit-animation-name: fadeInDownBig;
  animation-name: fadeInDownBig; }

@-webkit-keyframes fadeInLeft {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(-100%, 0, 0);
    transform: translate3d(-100%, 0, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes fadeInLeft {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(-100%, 0, 0);
    transform: translate3d(-100%, 0, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.fadeInLeft {
  -webkit-animation-name: fadeInLeft;
  animation-name: fadeInLeft; }

@-webkit-keyframes fadeInLeftBig {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(-2000px, 0, 0);
    transform: translate3d(-2000px, 0, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes fadeInLeftBig {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(-2000px, 0, 0);
    transform: translate3d(-2000px, 0, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.fadeInLeftBig {
  -webkit-animation-name: fadeInLeftBig;
  animation-name: fadeInLeftBig; }

@-webkit-keyframes fadeInRight {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(100%, 0, 0);
    transform: translate3d(100%, 0, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes fadeInRight {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(100%, 0, 0);
    transform: translate3d(100%, 0, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.fadeInRight {
  -webkit-animation-name: fadeInRight;
  animation-name: fadeInRight; }

@-webkit-keyframes fadeInRightBig {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(2000px, 0, 0);
    transform: translate3d(2000px, 0, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes fadeInRightBig {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(2000px, 0, 0);
    transform: translate3d(2000px, 0, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.fadeInRightBig {
  -webkit-animation-name: fadeInRightBig;
  animation-name: fadeInRightBig; }

@-webkit-keyframes fadeInUp {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, 100%, 0);
    transform: translate3d(0, 100%, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes fadeInUp {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, 100%, 0);
    transform: translate3d(0, 100%, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.fadeInUp {
  -webkit-animation-name: fadeInUp;
  animation-name: fadeInUp; }

@-webkit-keyframes fadeInUpBig {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, 2000px, 0);
    transform: translate3d(0, 2000px, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes fadeInUpBig {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(0, 2000px, 0);
    transform: translate3d(0, 2000px, 0); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.fadeInUpBig {
  -webkit-animation-name: fadeInUpBig;
  animation-name: fadeInUpBig; }

@-webkit-keyframes fadeOut {
  0% {
    opacity: 1; }
  100% {
    opacity: 0; } }

@keyframes fadeOut {
  0% {
    opacity: 1; }
  100% {
    opacity: 0; } }

.fadeOut {
  -webkit-animation-name: fadeOut;
  animation-name: fadeOut; }

@-webkit-keyframes fadeOutDown {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, 100%, 0);
    transform: translate3d(0, 100%, 0); } }

@keyframes fadeOutDown {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, 100%, 0);
    transform: translate3d(0, 100%, 0); } }

.fadeOutDown {
  -webkit-animation-name: fadeOutDown;
  animation-name: fadeOutDown; }

@-webkit-keyframes fadeOutDownBig {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, 2000px, 0);
    transform: translate3d(0, 2000px, 0); } }

@keyframes fadeOutDownBig {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, 2000px, 0);
    transform: translate3d(0, 2000px, 0); } }

.fadeOutDownBig {
  -webkit-animation-name: fadeOutDownBig;
  animation-name: fadeOutDownBig; }

@-webkit-keyframes fadeOutLeft {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(-100%, 0, 0);
    transform: translate3d(-100%, 0, 0); } }

@keyframes fadeOutLeft {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(-100%, 0, 0);
    transform: translate3d(-100%, 0, 0); } }

.fadeOutLeft {
  -webkit-animation-name: fadeOutLeft;
  animation-name: fadeOutLeft; }

@-webkit-keyframes fadeOutLeftBig {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(-2000px, 0, 0);
    transform: translate3d(-2000px, 0, 0); } }

@keyframes fadeOutLeftBig {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(-2000px, 0, 0);
    transform: translate3d(-2000px, 0, 0); } }

.fadeOutLeftBig {
  -webkit-animation-name: fadeOutLeftBig;
  animation-name: fadeOutLeftBig; }

@-webkit-keyframes fadeOutRight {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(100%, 0, 0);
    transform: translate3d(100%, 0, 0); } }

@keyframes fadeOutRight {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(100%, 0, 0);
    transform: translate3d(100%, 0, 0); } }

.fadeOutRight {
  -webkit-animation-name: fadeOutRight;
  animation-name: fadeOutRight; }

@-webkit-keyframes fadeOutRightBig {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(2000px, 0, 0);
    transform: translate3d(2000px, 0, 0); } }

@keyframes fadeOutRightBig {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(2000px, 0, 0);
    transform: translate3d(2000px, 0, 0); } }

.fadeOutRightBig {
  -webkit-animation-name: fadeOutRightBig;
  animation-name: fadeOutRightBig; }

@-webkit-keyframes fadeOutUp {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, -100%, 0);
    transform: translate3d(0, -100%, 0); } }

@keyframes fadeOutUp {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, -100%, 0);
    transform: translate3d(0, -100%, 0); } }

.fadeOutUp {
  -webkit-animation-name: fadeOutUp;
  animation-name: fadeOutUp; }

@-webkit-keyframes fadeOutUpBig {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, -2000px, 0);
    transform: translate3d(0, -2000px, 0); } }

@keyframes fadeOutUpBig {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(0, -2000px, 0);
    transform: translate3d(0, -2000px, 0); } }

.fadeOutUpBig {
  -webkit-animation-name: fadeOutUpBig;
  animation-name: fadeOutUpBig; }

@-webkit-keyframes flip {
  0% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -360deg);
    transform: perspective(400px) rotate3d(0, 1, 0, -360deg);
    -webkit-animation-timing-function: ease-out;
    animation-timing-function: ease-out; }
  40% {
    -webkit-transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -190deg);
    transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -190deg);
    -webkit-animation-timing-function: ease-out;
    animation-timing-function: ease-out; }
  50% {
    -webkit-transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -170deg);
    transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -170deg);
    -webkit-animation-timing-function: ease-in;
    animation-timing-function: ease-in; }
  80% {
    -webkit-transform: perspective(400px) scale3d(0.95, 0.95, 0.95);
    transform: perspective(400px) scale3d(0.95, 0.95, 0.95);
    -webkit-animation-timing-function: ease-in;
    animation-timing-function: ease-in; }
  100% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px);
    -webkit-animation-timing-function: ease-in;
    animation-timing-function: ease-in; } }

@keyframes flip {
  0% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -360deg);
    transform: perspective(400px) rotate3d(0, 1, 0, -360deg);
    -webkit-animation-timing-function: ease-out;
    animation-timing-function: ease-out; }
  40% {
    -webkit-transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -190deg);
    transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -190deg);
    -webkit-animation-timing-function: ease-out;
    animation-timing-function: ease-out; }
  50% {
    -webkit-transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -170deg);
    transform: perspective(400px) translate3d(0, 0, 150px) rotate3d(0, 1, 0, -170deg);
    -webkit-animation-timing-function: ease-in;
    animation-timing-function: ease-in; }
  80% {
    -webkit-transform: perspective(400px) scale3d(0.95, 0.95, 0.95);
    transform: perspective(400px) scale3d(0.95, 0.95, 0.95);
    -webkit-animation-timing-function: ease-in;
    animation-timing-function: ease-in; }
  100% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px);
    -webkit-animation-timing-function: ease-in;
    animation-timing-function: ease-in; } }

.animated.flip {
  -webkit-backface-visibility: visible;
  backface-visibility: visible;
  -webkit-animation-name: flip;
  animation-name: flip; }

@-webkit-keyframes flipInX {
  0% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 90deg);
    transform: perspective(400px) rotate3d(1, 0, 0, 90deg);
    -webkit-transition-timing-function: ease-in;
    transition-timing-function: ease-in;
    opacity: 0; }
  40% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -20deg);
    transform: perspective(400px) rotate3d(1, 0, 0, -20deg);
    -webkit-transition-timing-function: ease-in;
    transition-timing-function: ease-in; }
  60% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 10deg);
    transform: perspective(400px) rotate3d(1, 0, 0, 10deg);
    opacity: 1; }
  80% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -5deg);
    transform: perspective(400px) rotate3d(1, 0, 0, -5deg); }
  100% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px); } }

@keyframes flipInX {
  0% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 90deg);
    transform: perspective(400px) rotate3d(1, 0, 0, 90deg);
    -webkit-transition-timing-function: ease-in;
    transition-timing-function: ease-in;
    opacity: 0; }
  40% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -20deg);
    transform: perspective(400px) rotate3d(1, 0, 0, -20deg);
    -webkit-transition-timing-function: ease-in;
    transition-timing-function: ease-in; }
  60% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 10deg);
    transform: perspective(400px) rotate3d(1, 0, 0, 10deg);
    opacity: 1; }
  80% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -5deg);
    transform: perspective(400px) rotate3d(1, 0, 0, -5deg); }
  100% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px); } }

.flipInX {
  -webkit-backface-visibility: visible !important;
  backface-visibility: visible !important;
  -webkit-animation-name: flipInX;
  animation-name: flipInX; }

@-webkit-keyframes flipInY {
  0% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 90deg);
    transform: perspective(400px) rotate3d(0, 1, 0, 90deg);
    -webkit-transition-timing-function: ease-in;
    transition-timing-function: ease-in;
    opacity: 0; }
  40% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -20deg);
    transform: perspective(400px) rotate3d(0, 1, 0, -20deg);
    -webkit-transition-timing-function: ease-in;
    transition-timing-function: ease-in; }
  60% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 10deg);
    transform: perspective(400px) rotate3d(0, 1, 0, 10deg);
    opacity: 1; }
  80% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -5deg);
    transform: perspective(400px) rotate3d(0, 1, 0, -5deg); }
  100% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px); } }

@keyframes flipInY {
  0% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 90deg);
    transform: perspective(400px) rotate3d(0, 1, 0, 90deg);
    -webkit-transition-timing-function: ease-in;
    transition-timing-function: ease-in;
    opacity: 0; }
  40% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -20deg);
    transform: perspective(400px) rotate3d(0, 1, 0, -20deg);
    -webkit-transition-timing-function: ease-in;
    transition-timing-function: ease-in; }
  60% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 10deg);
    transform: perspective(400px) rotate3d(0, 1, 0, 10deg);
    opacity: 1; }
  80% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -5deg);
    transform: perspective(400px) rotate3d(0, 1, 0, -5deg); }
  100% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px); } }

.flipInY {
  -webkit-backface-visibility: visible !important;
  backface-visibility: visible !important;
  -webkit-animation-name: flipInY;
  animation-name: flipInY; }

@-webkit-keyframes flipOutX {
  0% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px); }
  30% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -20deg);
    transform: perspective(400px) rotate3d(1, 0, 0, -20deg);
    opacity: 1; }
  100% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 90deg);
    transform: perspective(400px) rotate3d(1, 0, 0, 90deg);
    opacity: 0; } }

@keyframes flipOutX {
  0% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px); }
  30% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, -20deg);
    transform: perspective(400px) rotate3d(1, 0, 0, -20deg);
    opacity: 1; }
  100% {
    -webkit-transform: perspective(400px) rotate3d(1, 0, 0, 90deg);
    transform: perspective(400px) rotate3d(1, 0, 0, 90deg);
    opacity: 0; } }

.flipOutX {
  -webkit-animation-name: flipOutX;
  animation-name: flipOutX;
  -webkit-backface-visibility: visible !important;
  backface-visibility: visible !important; }

@-webkit-keyframes flipOutY {
  0% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px); }
  30% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -15deg);
    transform: perspective(400px) rotate3d(0, 1, 0, -15deg);
    opacity: 1; }
  100% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 90deg);
    transform: perspective(400px) rotate3d(0, 1, 0, 90deg);
    opacity: 0; } }

@keyframes flipOutY {
  0% {
    -webkit-transform: perspective(400px);
    transform: perspective(400px); }
  30% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, -15deg);
    transform: perspective(400px) rotate3d(0, 1, 0, -15deg);
    opacity: 1; }
  100% {
    -webkit-transform: perspective(400px) rotate3d(0, 1, 0, 90deg);
    transform: perspective(400px) rotate3d(0, 1, 0, 90deg);
    opacity: 0; } }

.flipOutY {
  -webkit-backface-visibility: visible !important;
  backface-visibility: visible !important;
  -webkit-animation-name: flipOutY;
  animation-name: flipOutY; }

@-webkit-keyframes lightSpeedIn {
  0% {
    -webkit-transform: translate3d(100%, 0, 0) skewX(-30deg);
    transform: translate3d(100%, 0, 0) skewX(-30deg);
    opacity: 0; }
  60% {
    -webkit-transform: skewX(20deg);
    transform: skewX(20deg);
    opacity: 1; }
  80% {
    -webkit-transform: skewX(-5deg);
    transform: skewX(-5deg);
    opacity: 1; }
  100% {
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

@keyframes lightSpeedIn {
  0% {
    -webkit-transform: translate3d(100%, 0, 0) skewX(-30deg);
    transform: translate3d(100%, 0, 0) skewX(-30deg);
    opacity: 0; }
  60% {
    -webkit-transform: skewX(20deg);
    transform: skewX(20deg);
    opacity: 1; }
  80% {
    -webkit-transform: skewX(-5deg);
    transform: skewX(-5deg);
    opacity: 1; }
  100% {
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

.lightSpeedIn {
  -webkit-animation-name: lightSpeedIn;
  animation-name: lightSpeedIn;
  -webkit-animation-timing-function: ease-out;
  animation-timing-function: ease-out; }

@-webkit-keyframes lightSpeedOut {
  0% {
    opacity: 1; }
  100% {
    -webkit-transform: translate3d(100%, 0, 0) skewX(30deg);
    transform: translate3d(100%, 0, 0) skewX(30deg);
    opacity: 0; } }

@keyframes lightSpeedOut {
  0% {
    opacity: 1; }
  100% {
    -webkit-transform: translate3d(100%, 0, 0) skewX(30deg);
    transform: translate3d(100%, 0, 0) skewX(30deg);
    opacity: 0; } }

.lightSpeedOut {
  -webkit-animation-name: lightSpeedOut;
  animation-name: lightSpeedOut;
  -webkit-animation-timing-function: ease-in;
  animation-timing-function: ease-in; }

@-webkit-keyframes rotateIn {
  0% {
    -webkit-transform-origin: center;
    transform-origin: center;
    -webkit-transform: rotate3d(0, 0, 1, -200deg);
    transform: rotate3d(0, 0, 1, -200deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: center;
    transform-origin: center;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

@keyframes rotateIn {
  0% {
    -webkit-transform-origin: center;
    transform-origin: center;
    -webkit-transform: rotate3d(0, 0, 1, -200deg);
    transform: rotate3d(0, 0, 1, -200deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: center;
    transform-origin: center;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

.rotateIn {
  -webkit-animation-name: rotateIn;
  animation-name: rotateIn; }

@-webkit-keyframes rotateInDownLeft {
  0% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: rotate3d(0, 0, 1, -45deg);
    transform: rotate3d(0, 0, 1, -45deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

@keyframes rotateInDownLeft {
  0% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: rotate3d(0, 0, 1, -45deg);
    transform: rotate3d(0, 0, 1, -45deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

.rotateInDownLeft {
  -webkit-animation-name: rotateInDownLeft;
  animation-name: rotateInDownLeft; }

@-webkit-keyframes rotateInDownRight {
  0% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: rotate3d(0, 0, 1, 45deg);
    transform: rotate3d(0, 0, 1, 45deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

@keyframes rotateInDownRight {
  0% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: rotate3d(0, 0, 1, 45deg);
    transform: rotate3d(0, 0, 1, 45deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

.rotateInDownRight {
  -webkit-animation-name: rotateInDownRight;
  animation-name: rotateInDownRight; }

@-webkit-keyframes rotateInUpLeft {
  0% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: rotate3d(0, 0, 1, 45deg);
    transform: rotate3d(0, 0, 1, 45deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

@keyframes rotateInUpLeft {
  0% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: rotate3d(0, 0, 1, 45deg);
    transform: rotate3d(0, 0, 1, 45deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

.rotateInUpLeft {
  -webkit-animation-name: rotateInUpLeft;
  animation-name: rotateInUpLeft; }

@-webkit-keyframes rotateInUpRight {
  0% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: rotate3d(0, 0, 1, -90deg);
    transform: rotate3d(0, 0, 1, -90deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

@keyframes rotateInUpRight {
  0% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: rotate3d(0, 0, 1, -90deg);
    transform: rotate3d(0, 0, 1, -90deg);
    opacity: 0; }
  100% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: none;
    transform: none;
    opacity: 1; } }

.rotateInUpRight {
  -webkit-animation-name: rotateInUpRight;
  animation-name: rotateInUpRight; }

@-webkit-keyframes rotateOut {
  0% {
    -webkit-transform-origin: center;
    transform-origin: center;
    opacity: 1; }
  100% {
    -webkit-transform-origin: center;
    transform-origin: center;
    -webkit-transform: rotate3d(0, 0, 1, 200deg);
    transform: rotate3d(0, 0, 1, 200deg);
    opacity: 0; } }

@keyframes rotateOut {
  0% {
    -webkit-transform-origin: center;
    transform-origin: center;
    opacity: 1; }
  100% {
    -webkit-transform-origin: center;
    transform-origin: center;
    -webkit-transform: rotate3d(0, 0, 1, 200deg);
    transform: rotate3d(0, 0, 1, 200deg);
    opacity: 0; } }

.rotateOut {
  -webkit-animation-name: rotateOut;
  animation-name: rotateOut; }

@-webkit-keyframes rotateOutDownLeft {
  0% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    opacity: 1; }
  100% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: rotate3d(0, 0, 1, 45deg);
    transform: rotate3d(0, 0, 1, 45deg);
    opacity: 0; } }

@keyframes rotateOutDownLeft {
  0% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    opacity: 1; }
  100% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: rotate3d(0, 0, 1, 45deg);
    transform: rotate3d(0, 0, 1, 45deg);
    opacity: 0; } }

.rotateOutDownLeft {
  -webkit-animation-name: rotateOutDownLeft;
  animation-name: rotateOutDownLeft; }

@-webkit-keyframes rotateOutDownRight {
  0% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    opacity: 1; }
  100% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: rotate3d(0, 0, 1, -45deg);
    transform: rotate3d(0, 0, 1, -45deg);
    opacity: 0; } }

@keyframes rotateOutDownRight {
  0% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    opacity: 1; }
  100% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: rotate3d(0, 0, 1, -45deg);
    transform: rotate3d(0, 0, 1, -45deg);
    opacity: 0; } }

.rotateOutDownRight {
  -webkit-animation-name: rotateOutDownRight;
  animation-name: rotateOutDownRight; }

@-webkit-keyframes rotateOutUpLeft {
  0% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    opacity: 1; }
  100% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: rotate3d(0, 0, 1, -45deg);
    transform: rotate3d(0, 0, 1, -45deg);
    opacity: 0; } }

@keyframes rotateOutUpLeft {
  0% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    opacity: 1; }
  100% {
    -webkit-transform-origin: left bottom;
    transform-origin: left bottom;
    -webkit-transform: rotate3d(0, 0, 1, -45deg);
    transform: rotate3d(0, 0, 1, -45deg);
    opacity: 0; } }

.rotateOutUpLeft {
  -webkit-animation-name: rotateOutUpLeft;
  animation-name: rotateOutUpLeft; }

@-webkit-keyframes rotateOutUpRight {
  0% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    opacity: 1; }
  100% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: rotate3d(0, 0, 1, 90deg);
    transform: rotate3d(0, 0, 1, 90deg);
    opacity: 0; } }

@keyframes rotateOutUpRight {
  0% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    opacity: 1; }
  100% {
    -webkit-transform-origin: right bottom;
    transform-origin: right bottom;
    -webkit-transform: rotate3d(0, 0, 1, 90deg);
    transform: rotate3d(0, 0, 1, 90deg);
    opacity: 0; } }

.rotateOutUpRight {
  -webkit-animation-name: rotateOutUpRight;
  animation-name: rotateOutUpRight; }

@-webkit-keyframes hinge {
  0% {
    -webkit-transform-origin: top left;
    transform-origin: top left;
    -webkit-animation-timing-function: ease-in-out;
    animation-timing-function: ease-in-out; }
  20%, 60% {
    -webkit-transform: rotate3d(0, 0, 1, 80deg);
    transform: rotate3d(0, 0, 1, 80deg);
    -webkit-transform-origin: top left;
    transform-origin: top left;
    -webkit-animation-timing-function: ease-in-out;
    animation-timing-function: ease-in-out; }
  40%, 80% {
    -webkit-transform: rotate3d(0, 0, 1, 60deg);
    transform: rotate3d(0, 0, 1, 60deg);
    -webkit-transform-origin: top left;
    transform-origin: top left;
    -webkit-animation-timing-function: ease-in-out;
    animation-timing-function: ease-in-out;
    opacity: 1; }
  100% {
    -webkit-transform: translate3d(0, 700px, 0);
    transform: translate3d(0, 700px, 0);
    opacity: 0; } }

@keyframes hinge {
  0% {
    -webkit-transform-origin: top left;
    transform-origin: top left;
    -webkit-animation-timing-function: ease-in-out;
    animation-timing-function: ease-in-out; }
  20%, 60% {
    -webkit-transform: rotate3d(0, 0, 1, 80deg);
    transform: rotate3d(0, 0, 1, 80deg);
    -webkit-transform-origin: top left;
    transform-origin: top left;
    -webkit-animation-timing-function: ease-in-out;
    animation-timing-function: ease-in-out; }
  40%, 80% {
    -webkit-transform: rotate3d(0, 0, 1, 60deg);
    transform: rotate3d(0, 0, 1, 60deg);
    -webkit-transform-origin: top left;
    transform-origin: top left;
    -webkit-animation-timing-function: ease-in-out;
    animation-timing-function: ease-in-out;
    opacity: 1; }
  100% {
    -webkit-transform: translate3d(0, 700px, 0);
    transform: translate3d(0, 700px, 0);
    opacity: 0; } }

.hinge {
  -webkit-animation-name: hinge;
  animation-name: hinge; }

/* originally authored by Nick Pettit - https://github.com/nickpettit/glide */
@-webkit-keyframes rollIn {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(-100%, 0, 0) rotate3d(0, 0, 1, -120deg);
    transform: translate3d(-100%, 0, 0) rotate3d(0, 0, 1, -120deg); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

@keyframes rollIn {
  0% {
    opacity: 0;
    -webkit-transform: translate3d(-100%, 0, 0) rotate3d(0, 0, 1, -120deg);
    transform: translate3d(-100%, 0, 0) rotate3d(0, 0, 1, -120deg); }
  100% {
    opacity: 1;
    -webkit-transform: none;
    transform: none; } }

.rollIn {
  -webkit-animation-name: rollIn;
  animation-name: rollIn; }

/* originally authored by Nick Pettit - https://github.com/nickpettit/glide */
@-webkit-keyframes rollOut {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(100%, 0, 0) rotate3d(0, 0, 1, 120deg);
    transform: translate3d(100%, 0, 0) rotate3d(0, 0, 1, 120deg); } }

@keyframes rollOut {
  0% {
    opacity: 1; }
  100% {
    opacity: 0;
    -webkit-transform: translate3d(100%, 0, 0) rotate3d(0, 0, 1, 120deg);
    transform: translate3d(100%, 0, 0) rotate3d(0, 0, 1, 120deg); } }

.rollOut {
  -webkit-animation-name: rollOut;
  animation-name: rollOut; }

@-webkit-keyframes zoomIn {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.3, 0.3, 0.3);
    transform: scale3d(0.3, 0.3, 0.3); }
  50% {
    opacity: 1; } }

@keyframes zoomIn {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.3, 0.3, 0.3);
    transform: scale3d(0.3, 0.3, 0.3); }
  50% {
    opacity: 1; } }

.zoomIn {
  -webkit-animation-name: zoomIn;
  animation-name: zoomIn; }

@-webkit-keyframes zoomInDown {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(0, -1000px, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(0, -1000px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(0, 60px, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(0, 60px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

@keyframes zoomInDown {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(0, -1000px, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(0, -1000px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(0, 60px, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(0, 60px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

.zoomInDown {
  -webkit-animation-name: zoomInDown;
  animation-name: zoomInDown; }

@-webkit-keyframes zoomInLeft {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(-1000px, 0, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(-1000px, 0, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(10px, 0, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(10px, 0, 0);
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

@keyframes zoomInLeft {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(-1000px, 0, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(-1000px, 0, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(10px, 0, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(10px, 0, 0);
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

.zoomInLeft {
  -webkit-animation-name: zoomInLeft;
  animation-name: zoomInLeft; }

@-webkit-keyframes zoomInRight {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(1000px, 0, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(1000px, 0, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(-10px, 0, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(-10px, 0, 0);
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

@keyframes zoomInRight {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(1000px, 0, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(1000px, 0, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(-10px, 0, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(-10px, 0, 0);
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

.zoomInRight {
  -webkit-animation-name: zoomInRight;
  animation-name: zoomInRight; }

@-webkit-keyframes zoomInUp {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(0, 1000px, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(0, 1000px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(0, -60px, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(0, -60px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

@keyframes zoomInUp {
  0% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(0, 1000px, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(0, 1000px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  60% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(0, -60px, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(0, -60px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

.zoomInUp {
  -webkit-animation-name: zoomInUp;
  animation-name: zoomInUp; }

@-webkit-keyframes zoomOut {
  0% {
    opacity: 1; }
  50% {
    opacity: 0;
    -webkit-transform: scale3d(0.3, 0.3, 0.3);
    transform: scale3d(0.3, 0.3, 0.3); }
  100% {
    opacity: 0; } }

@keyframes zoomOut {
  0% {
    opacity: 1; }
  50% {
    opacity: 0;
    -webkit-transform: scale3d(0.3, 0.3, 0.3);
    transform: scale3d(0.3, 0.3, 0.3); }
  100% {
    opacity: 0; } }

.zoomOut {
  -webkit-animation-name: zoomOut;
  animation-name: zoomOut; }

@-webkit-keyframes zoomOutDown {
  40% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(0, -60px, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(0, -60px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  100% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(0, 2000px, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(0, 2000px, 0);
    -webkit-transform-origin: center bottom;
    transform-origin: center bottom;
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

@keyframes zoomOutDown {
  40% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(0, -60px, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(0, -60px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  100% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(0, 2000px, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(0, 2000px, 0);
    -webkit-transform-origin: center bottom;
    transform-origin: center bottom;
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

.zoomOutDown {
  -webkit-animation-name: zoomOutDown;
  animation-name: zoomOutDown; }

@-webkit-keyframes zoomOutLeft {
  40% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(42px, 0, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(42px, 0, 0); }
  100% {
    opacity: 0;
    -webkit-transform: scale(0.1) translate3d(-2000px, 0, 0);
    transform: scale(0.1) translate3d(-2000px, 0, 0);
    -webkit-transform-origin: left center;
    transform-origin: left center; } }

@keyframes zoomOutLeft {
  40% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(42px, 0, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(42px, 0, 0); }
  100% {
    opacity: 0;
    -webkit-transform: scale(0.1) translate3d(-2000px, 0, 0);
    transform: scale(0.1) translate3d(-2000px, 0, 0);
    -webkit-transform-origin: left center;
    transform-origin: left center; } }

.zoomOutLeft {
  -webkit-animation-name: zoomOutLeft;
  animation-name: zoomOutLeft; }

@-webkit-keyframes zoomOutRight {
  40% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(-42px, 0, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(-42px, 0, 0); }
  100% {
    opacity: 0;
    -webkit-transform: scale(0.1) translate3d(2000px, 0, 0);
    transform: scale(0.1) translate3d(2000px, 0, 0);
    -webkit-transform-origin: right center;
    transform-origin: right center; } }

@keyframes zoomOutRight {
  40% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(-42px, 0, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(-42px, 0, 0); }
  100% {
    opacity: 0;
    -webkit-transform: scale(0.1) translate3d(2000px, 0, 0);
    transform: scale(0.1) translate3d(2000px, 0, 0);
    -webkit-transform-origin: right center;
    transform-origin: right center; } }

.zoomOutRight {
  -webkit-animation-name: zoomOutRight;
  animation-name: zoomOutRight; }

@-webkit-keyframes zoomOutUp {
  40% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(0, 60px, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(0, 60px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  100% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(0, -2000px, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(0, -2000px, 0);
    -webkit-transform-origin: center bottom;
    transform-origin: center bottom;
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

@keyframes zoomOutUp {
  40% {
    opacity: 1;
    -webkit-transform: scale3d(0.475, 0.475, 0.475) translate3d(0, 60px, 0);
    transform: scale3d(0.475, 0.475, 0.475) translate3d(0, 60px, 0);
    -webkit-animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19);
    animation-timing-function: cubic-bezier(0.55, 0.055, 0.675, 0.19); }
  100% {
    opacity: 0;
    -webkit-transform: scale3d(0.1, 0.1, 0.1) translate3d(0, -2000px, 0);
    transform: scale3d(0.1, 0.1, 0.1) translate3d(0, -2000px, 0);
    -webkit-transform-origin: center bottom;
    transform-origin: center bottom;
    -webkit-animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1);
    animation-timing-function: cubic-bezier(0.175, 0.885, 0.32, 1); } }

.zoomOutUp {
  -webkit-animation-name: zoomOutUp;
  animation-name: zoomOutUp; }

@-webkit-keyframes slideInDown {
  0% {
    -webkit-transform: translate3d(0, -100%, 0);
    transform: translate3d(0, -100%, 0);
    visibility: visible; }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

@keyframes slideInDown {
  0% {
    -webkit-transform: translate3d(0, -100%, 0);
    transform: translate3d(0, -100%, 0);
    visibility: visible; }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

.slideInDown {
  -webkit-animation-name: slideInDown;
  animation-name: slideInDown; }

@-webkit-keyframes slideInLeft {
  0% {
    -webkit-transform: translate3d(-100%, 0, 0);
    transform: translate3d(-100%, 0, 0);
    visibility: visible; }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

@keyframes slideInLeft {
  0% {
    -webkit-transform: translate3d(-100%, 0, 0);
    transform: translate3d(-100%, 0, 0);
    visibility: visible; }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

.slideInLeft {
  -webkit-animation-name: slideInLeft;
  animation-name: slideInLeft; }

@-webkit-keyframes slideInRight {
  0% {
    -webkit-transform: translate3d(100%, 0, 0);
    transform: translate3d(100%, 0, 0);
    visibility: visible; }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

@keyframes slideInRight {
  0% {
    -webkit-transform: translate3d(100%, 0, 0);
    transform: translate3d(100%, 0, 0);
    visibility: visible; }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

.slideInRight {
  -webkit-animation-name: slideInRight;
  animation-name: slideInRight; }

@-webkit-keyframes slideInUp {
  0% {
    -webkit-transform: translate3d(0, 100%, 0);
    transform: translate3d(0, 100%, 0);
    visibility: visible; }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

@keyframes slideInUp {
  0% {
    -webkit-transform: translate3d(0, 100%, 0);
    transform: translate3d(0, 100%, 0);
    visibility: visible; }
  100% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); } }

.slideInUp {
  -webkit-animation-name: slideInUp;
  animation-name: slideInUp; }

@-webkit-keyframes slideOutDown {
  0% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  100% {
    visibility: hidden;
    -webkit-transform: translate3d(0, 100%, 0);
    transform: translate3d(0, 100%, 0); } }

@keyframes slideOutDown {
  0% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  100% {
    visibility: hidden;
    -webkit-transform: translate3d(0, 100%, 0);
    transform: translate3d(0, 100%, 0); } }

.slideOutDown {
  -webkit-animation-name: slideOutDown;
  animation-name: slideOutDown; }

@-webkit-keyframes slideOutLeft {
  0% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  100% {
    visibility: hidden;
    -webkit-transform: translate3d(-100%, 0, 0);
    transform: translate3d(-100%, 0, 0); } }

@keyframes slideOutLeft {
  0% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  100% {
    visibility: hidden;
    -webkit-transform: translate3d(-100%, 0, 0);
    transform: translate3d(-100%, 0, 0); } }

.slideOutLeft {
  -webkit-animation-name: slideOutLeft;
  animation-name: slideOutLeft; }

@-webkit-keyframes slideOutRight {
  0% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  100% {
    visibility: hidden;
    -webkit-transform: translate3d(100%, 0, 0);
    transform: translate3d(100%, 0, 0); } }

@keyframes slideOutRight {
  0% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  100% {
    visibility: hidden;
    -webkit-transform: translate3d(100%, 0, 0);
    transform: translate3d(100%, 0, 0); } }

.slideOutRight {
  -webkit-animation-name: slideOutRight;
  animation-name: slideOutRight; }

@-webkit-keyframes slideOutUp {
  0% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  100% {
    visibility: hidden;
    -webkit-transform: translate3d(0, -100%, 0);
    transform: translate3d(0, -100%, 0); } }

@keyframes slideOutUp {
  0% {
    -webkit-transform: translate3d(0, 0, 0);
    transform: translate3d(0, 0, 0); }
  100% {
    visibility: hidden;
    -webkit-transform: translate3d(0, -100%, 0);
    transform: translate3d(0, -100%, 0); } }

.slideOutUp {
  -webkit-animation-name: slideOutUp;
  animation-name: slideOutUp; }

/*!
 * Cropper.js v0.8.1
 * https://github.com/fengyuanchen/cropperjs
 *
 * Copyright (c) 2015-2016 Fengyuan Chen
 * Released under the MIT license
 *
 * Date: 2016-09-03T04:55:16.458Z
 */
.cropper-container {
  font-size: 0;
  line-height: 0;
  position: relative;
  -webkit-user-select: none;
  -moz-user-select: none;
  -ms-user-select: none;
  user-select: none;
  direction: ltr; }
  .cropper-container img {
    display: block;
    min-width: 0 !important;
    max-width: none !important;
    min-height: 0 !important;
    max-height: none !important;
    width: 100%;
    height: 100%;
    image-orientation: 0deg; }

.cropper-wrap-box, .cropper-canvas, .cropper-drag-box, .cropper-crop-box, .cropper-modal {
  position: absolute;
  top: 0;
  right: 0;
  bottom: 0;
  left: 0; }

.cropper-wrap-box {
  overflow: hidden; }

.cropper-drag-box {
  opacity: 0;
  background-color: #fff; }

.cropper-modal {
  opacity: .5;
  background-color: #000; }

.cropper-view-box {
  display: block;
  overflow: hidden;
  width: 100%;
  height: 100%;
  outline: 1px solid #39f;
  outline-color: rgba(51, 153, 255, 0.75); }

.cropper-dashed {
  position: absolute;
  display: block;
  opacity: .5;
  border: 0 dashed #eee; }
  .cropper-dashed.dashed-h {
    top: 33.33333333%;
    left: 0;
    width: 100%;
    height: 33.33333333%;
    border-top-width: 1px;
    border-bottom-width: 1px; }
  .cropper-dashed.dashed-v {
    top: 0;
    left: 33.33333333%;
    width: 33.33333333%;
    height: 100%;
    border-right-width: 1px;
    border-left-width: 1px; }

.cropper-center {
  position: absolute;
  top: 50%;
  left: 50%;
  display: block;
  width: 0;
  height: 0;
  opacity: .75; }
  .cropper-center:before, .cropper-center:after {
    position: absolute;
    display: block;
    content: ' ';
    background-color: #eee; }
  .cropper-center:before {
    top: 0;
    left: -3px;
    width: 7px;
    height: 1px; }
  .cropper-center:after {
    top: -3px;
    left: 0;
    width: 1px;
    height: 7px; }

.cropper-face, .cropper-line, .cropper-point {
  position: absolute;
  display: block;
  width: 100%;
  height: 100%;
  opacity: .2; }

.cropper-face {
  top: 0;
  left: 0;
  background-color: #fff; }

.cropper-line {
  background-color: #39f; }
  .cropper-line.line-e {
    top: 0;
    right: -3px;
    width: 5px;
    cursor: e-resize; }
  .cropper-line.line-n {
    top: -3px;
    left: 0;
    height: 5px;
    cursor: n-resize; }
  .cropper-line.line-w {
    top: 0;
    left: -3px;
    width: 5px;
    cursor: w-resize; }
  .cropper-line.line-s {
    bottom: -3px;
    left: 0;
    height: 5px;
    cursor: s-resize; }

.cropper-point {
  width: 5px;
  height: 5px;
  opacity: .75;
  background-color: #39f; }
  .cropper-point.point-e {
    top: 50%;
    right: -3px;
    margin-top: -3px;
    cursor: e-resize; }
  .cropper-point.point-n {
    top: -3px;
    left: 50%;
    margin-left: -3px;
    cursor: n-resize; }
  .cropper-point.point-w {
    top: 50%;
    left: -3px;
    margin-top: -3px;
    cursor: w-resize; }
  .cropper-point.point-s {
    bottom: -3px;
    left: 50%;
    margin-left: -3px;
    cursor: s-resize; }
  .cropper-point.point-ne {
    top: -3px;
    right: -3px;
    cursor: ne-resize; }
  .cropper-point.point-nw {
    top: -3px;
    left: -3px;
    cursor: nw-resize; }
  .cropper-point.point-sw {
    bottom: -3px;
    left: -3px;
    cursor: sw-resize; }
  .cropper-point.point-se {
    right: -3px;
    bottom: -3px;
    width: 20px;
    height: 20px;
    cursor: se-resize;
    opacity: 1; }
    .cropper-point.point-se:before {
      position: absolute;
      right: -50%;
      bottom: -50%;
      display: block;
      width: 200%;
      height: 200%;
      content: ' ';
      opacity: 0;
      background-color: #39f; }

@media (min-width: 768px) {
  .cropper-point.point-se {
    width: 15px;
    height: 15px; } }

@media (min-width: 992px) {
  .cropper-point.point-se {
    width: 10px;
    height: 10px; } }

@media (min-width: 1200px) {
  .cropper-point.point-se {
    width: 5px;
    height: 5px;
    opacity: .75; } }

.cropper-invisible {
  opacity: 0; }

.cropper-bg {
  background-image: url("data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABAAAAAQAQMAAAAlPW0iAAAAA3NCSVQICAjb4U/gAAAABlBMVEXMzMz////TjRV2AAAACXBIWXMAAArrAAAK6wGCiw1aAAAAHHRFWHRTb2Z0d2FyZQBBZG9iZSBGaXJld29ya3MgQ1M26LyyjAAAABFJREFUCJlj+M/AgBVhF/0PAH6/D/HkDxOGAAAAAElFTkSuQmCC"); }

.cropper-hide {
  position: absolute;
  display: block;
  width: 0;
  height: 0; }

.cropper-hidden {
  display: none !important; }

.cropper-move {
  cursor: move; }

.cropper-crop {
  cursor: crosshair; }

.cropper-disabled .cropper-drag-box, .cropper-disabled .cropper-face, .cropper-disabled .cropper-line, .cropper-disabled .cropper-point {
  cursor: not-allowed; }

/*! Flickity v2.0.5
http://flickity.metafizzy.co
---------------------------------------------- */
.flickity-enabled {
  position: relative; }

.flickity-enabled:focus {
  outline: none; }

.flickity-viewport {
  overflow: hidden;
  position: relative;
  height: 100%; }

.flickity-slider {
  position: absolute;
  width: 100%;
  height: 100%; }

/* draggable */
.flickity-enabled.is-draggable {
  -webkit-tap-highlight-color: transparent;
  tap-highlight-color: transparent;
  -webkit-user-select: none;
  -moz-user-select: none;
  -ms-user-select: none;
  user-select: none; }

.flickity-enabled.is-draggable .flickity-viewport {
  cursor: move;
  cursor: -webkit-grab;
  cursor: grab; }

.flickity-enabled.is-draggable .flickity-viewport.is-pointer-down {
  cursor: -webkit-grabbing;
  cursor: grabbing; }

/* ---- previous/next buttons ---- */
.flickity-prev-next-button {
  position: absolute;
  top: 50%;
  width: 44px;
  height: 44px;
  border: none;
  border-radius: 50%;
  background: white;
  background: rgba(255, 255, 255, 0.75);
  cursor: pointer;
  /* vertically center */
  -webkit-transform: translateY(-50%);
  transform: translateY(-50%); }

.flickity-prev-next-button:hover {
  background: white; }

.flickity-prev-next-button:focus {
  outline: none;
  box-shadow: 0 0 0 5px #09F; }

.flickity-prev-next-button:active {
  opacity: 0.6; }

.flickity-prev-next-button.previous {
  left: 10px; }

.flickity-prev-next-button.next {
  right: 10px; }

/* right to left */
.flickity-rtl .flickity-prev-next-button.previous {
  left: auto;
  right: 10px; }

.flickity-rtl .flickity-prev-next-button.next {
  right: auto;
  left: 10px; }

.flickity-prev-next-button:disabled {
  opacity: 0.3;
  cursor: auto; }

.flickity-prev-next-button svg {
  position: absolute;
  left: 20%;
  top: 20%;
  width: 60%;
  height: 60%; }

.flickity-prev-next-button .arrow {
  fill: #333; }

/* ---- page dots ---- */
.flickity-page-dots {
  position: absolute;
  width: 100%;
  bottom: -25px;
  padding: 0;
  margin: 0;
  list-style: none;
  text-align: center;
  line-height: 1; }

.flickity-rtl .flickity-page-dots {
  direction: rtl; }

.flickity-page-dots .dot {
  display: inline-block;
  width: 10px;
  height: 10px;
  margin: 0 8px;
  background: #333;
  border-radius: 50%;
  opacity: 0.25;
  cursor: pointer; }

.flickity-page-dots .dot.is-selected {
  opacity: 1; }

@-webkit-keyframes ngdialog-fadeout {
  0% {
    opacity: 1; }
  100% {
    opacity: 0; } }

@keyframes ngdialog-fadeout {
  0% {
    opacity: 1; }
  100% {
    opacity: 0; } }

@-webkit-keyframes ngdialog-fadein {
  0% {
    opacity: 0; }
  100% {
    opacity: 1; } }

@keyframes ngdialog-fadein {
  0% {
    opacity: 0; }
  100% {
    opacity: 1; } }

.ngdialog {
  -webkit-box-sizing: border-box;
  -moz-box-sizing: border-box;
  box-sizing: border-box; }

.ngdialog *,
.ngdialog *:before,
.ngdialog *:after {
  -webkit-box-sizing: inherit;
  -moz-box-sizing: inherit;
  box-sizing: inherit; }

.ngdialog {
  position: fixed;
  overflow: auto;
  -webkit-overflow-scrolling: touch;
  z-index: 10000;
  top: 0;
  right: 0;
  bottom: 0;
  left: 0; }

.ngdialog.ngdialog-disabled-animation * {
  -webkit-animation: none !important;
  animation: none !important; }

.ngdialog-overlay {
  position: fixed;
  background: rgba(0, 0, 0, 0.4);
  top: 0;
  right: 0;
  bottom: 0;
  left: 0;
  pointer-events: none;
  -webkit-backface-visibility: hidden;
  -webkit-animation: ngdialog-fadein 0.5s;
  animation: ngdialog-fadein 0.5s; }

.ngdialog.ngdialog-closing .ngdialog-overlay {
  -webkit-backface-visibility: hidden;
  -webkit-animation: ngdialog-fadeout 0.5s;
  animation: ngdialog-fadeout 0.5s; }

.ngdialog-content {
  background: white;
  -webkit-backface-visibility: hidden;
  -webkit-animation: ngdialog-fadein 0.5s;
  animation: ngdialog-fadein 0.5s; }

.ngdialog.ngdialog-closing .ngdialog-content {
  -webkit-backface-visibility: hidden;
  -webkit-animation: ngdialog-fadeout 0.5s;
  animation: ngdialog-fadeout 0.5s; }

.ngdialog-close:before {
  font-family: 'Helvetica', Arial, sans-serif;
  content: '\00D7';
  cursor: pointer; }

.cg-notify-message {
  position: fixed;
  top: 0px;
  z-index: 9999;
  max-width: 40rem;
  -webkit-transition: top 0.5s ease-out,opacity 0.2s ease-out;
  -moz-transition: top 0.5s ease-out,opacity 0.2s ease-out;
  -o-transition: top 0.5s ease-out,opacity 0.2s ease-out;
  transition: top 0.5s ease-out,opacity 0.2s ease-out;
  visibility: hidden; }

.cg-notify-message-center {
  left: 50%; }

.cg-notify-message-left {
  left: 15px; }

.cg-notify-message-right {
  right: 15px; }

.cg-notify-message a {
  font-weight: bold;
  color: inherit; }

.cg-notify-message a:hover {
  color: inherit; }

.cg-notify-close {
  -webkit-appearance: none;
  padding: 0;
  cursor: pointer;
  background: 0 0;
  border: 0;
  font-size: 21px;
  font-weight: 700;
  line-height: 1;
  color: #000;
  text-shadow: 0 1px 0 #fff;
  filter: alpha(opacity=20);
  opacity: .2;
  position: absolute;
  top: 0px;
  right: 3px;
  line-height: 15px; }

.cg-notify-close:hover, .cg-notify-close:focus {
  color: #000;
  text-decoration: none;
  cursor: pointer;
  filter: alpha(opacity=50);
  opacity: .5; }

.cg-notify-sr-only {
  position: absolute;
  width: 1px;
  height: 1px;
  padding: 0;
  margin: -1px;
  overflow: hidden;
  clip: rect(0, 0, 0, 0);
  border: 0; }

/*
	Redactor II

	http://imperavi.com/redactor/

	Copyright (c) 2009-2017, Imperavi Oy.
	License: http://imperavi.com/redactor/license/
*/
@font-face {
  font-family: 'Redactor';
  src: url("data:application/x-font-ttf;charset=utf-8;base64,AAEAAAALAIAAAwAwT1MvMg8SBkUAAAC8AAAAYGNtYXAXVtKuAAABHAAAAFRnYXNwAAAAEAAAAXAAAAAIZ2x5ZnzExC8AAAF4AAAcJGhlYWQMgV4/AAAdnAAAADZoaGVhB7gD6QAAHdQAAAAkaG10eKYBDw8AAB34AAAAsGxvY2GR7orEAAAeqAAAAFptYXhwADQApgAAHwQAAAAgbmFtZVDOJQoAAB8kAAABknBvc3QAAwAAAAAguAAAACAAAwP0AZAABQAAApkCzAAAAI8CmQLMAAAB6wAzAQkAAAAAAAAAAAAAAAAAAAABEAAAAAAAAAAAAAAAAAAAAABAAADpJwPA/8AAQAPAAEAAAAABAAAAAAAAAAAAAAAgAAAAAAADAAAAAwAAABwAAQADAAAAHAADAAEAAAAcAAQAOAAAAAoACAACAAIAAQAg6Sf//f//AAAAAAAg6QD//f//AAH/4xcEAAMAAQAAAAAAAAAAAAAAAQAB//8ADwABAAAAAAAAAAAAAgAANzkBAAAAAAEAAAAAAAAAAAACAAA3OQEAAAAAAQAAAAAAAAAAAAIAADc5AQAAAAADAAAAgAQAAwAADwAjADMAABMhMhYdARQGIyEiJj0BNDYDITIWHQEUBiMhOAExIiY9ATQ2MxMhMhYdARQGIyEiJj0BNDa7AooZIiIZ/XYZIiJnA4oZIiIZ/HYYIyIZgAKKGSIiGf12GSIiAwAiGQoZIiIZChki/wAiGQkZIiIYChki/wAiGQoZIiIZChkiAAADAAAAgAQAAwAAEAAkADUAABMhMhYdARQGIyEiJj0BNDYzESEyFh0BFAYjITgBMSImPQE0NjMRITIWHQEUBiMhIiY9ATQ2MzsCyhkiIhn9NhkiIhkDihkiIhn8dhgjIhkCyhkiIhn9NhkiIhkDACIZChkiIhkKGSL/ACIZCRkiIhgKGSL/ACIZChkiIhkKGSIAAAAAAwAAAIAEAAMAAA8AIwAzAAATITIWHQEUBiMhIiY9ATQ2AyEyFh0BFAYjITgBMSImPQE0NjMTITIWHQEUBiMhIiY9ATQ2+wLKGSIiGf02GSIipwOKGSIiGfx2GCMiGcACyhkiIhn9NhkiIgMAIhkKGSIiGQoZIv8AIhkJGSIiGAoZIv8AIhkKGSIiGQoZIgAAAwEZAEcC5wMAACUALgBLAAAlPgE1NCY1NjQ1NCYnPgE3PAE1NCYnLgEjKgEjIgcRMzIWMzI2NwMyFRQjIiM1MwM6ATMyFhceARUcARUcARUUBgcOASMiJiMiJzUzAp8hJwEBSDckMAEhGyFRLQIFAjiIzwMGAzBYJMpqdx8cRgcFCQUcNBYPEhUSFjQcBAkEFiZAgBlKLAEEAQMHAz1dEBFFKwEDASY/FhgbBv1OAR8bAhZPWqb+/w4ODSgXAgUCAgQCGSwODg8BA+MAAgDAAAADQAOAACcAMwAAJSImJzEnBw4BIzgBMSoBIyImJxE+ATM6ATMhOgEzMhYXEQ4BIyoBIwERNz4BMzIWFzEXEQMACxMI2toIEwsBAgEYIgICIhgBAgECAAECARgiAgIiGAECAf5AmgcUCgsTCJsABwWOjgYGIBcDERggIRf88BchAxD9mGUGBgYGZQJoAAAAAAUAQAAAA8ADgAAPABMAIQAvAD0AAAEhIgYVERQWMyEyNjURNCYDIREhBSEyFhUUBiMhIiY1NDYXITIWFRQGIyEiJjU0NhchMhYVFAYjISImNTQ2A0D9gDVLSzUCgDVLSzX9gAKA/gABgBslJRv+gBslJRsBgBslJRv+gBslJRsBgBslJRv+gBslJQOASzX9gDVLSzUCgDVL/QACgEAlGxslJRsbJcAlGxslJRsbJcAlGxslJRsbJQADAEAAAAPAA4AADwATAE4AAAEhIgYVERQWMyEyNjURNCYDIREhAzEHDgEjOAExKgEjIiYnNDY3MTcjMCIxIiYnNDY3MTc+ATM4ATE6ATMyFhcUBgcxBzMwMjEyFhcUBgcDQP2ANUtLNQKANUtLNf2AAoCIwAUQCQEBAQ4UAgQElOkCDhUBBATABRAJAQEBDhQCBASU6QIOFQEEBAOASzX9gDVLSzUCgDVL/QACgP6t4AYHEg4FCgStEg4FCgTgBgcSDgUKBK0SDgUKBAABAIAAPAOAAwEAbQAAASMuAS8BLgEnLgEnLgE1MDQ1PAE1NDY3PgEzOgEzHgEXHgEXNy4BIyoBByoBIyIGBw4BFRwBFRwBFRQWFx4BHwEhFSEXHgEVHAEVFAYHDgEjKgEjLgEnLgEnBx4BMzoBMzIWMzI2Nz4BNy4BJxcDgPQSKBc7FSMRCA0FBQUPDQ0jEwIEAhMkEQ8cDRocQiQHDgYBBAImRBoZHQ8NEzAdMf6dAcQECQoSDxEqGAEEARMkEREgDiEfTCkCBAMCBwMsTiAdIgEBCAfUAYASHQsbChUNBhIKCxcNAQEBAQEUIg0LDgEGBgUNCFEREwEbGBc/JQEDAQECAhw1FxgmCxdABA4hEQEBARYmDg4QAQcGBRALVxUWAR0aF0QoFCYSAgACAEAAAAPAA4AAGgA2AAABBzMyFhUUBisBIiY9ATQ2MzIWHQE3HgEXFDY/ASMiJjU0NjsBMhYdARQGIyImPQEHLgEnNAY3AcDnRxMaGhOzExoaExIb5hgiBgZ650cTGhoTsxMaGhMSG+YYIgYGBgFA5hsSExoaE7MTGhoTR+cFIxcKD/rmGxITGhoTsxMaGhNH5wUjFwoPBgAAAAADAEAAQAPAA4AAFwAaAB4AAAEjFTMRIREzNSMiBhURFBYzITI2NRE0JgEHISczESMDQICA/YCAgDVLSzUCgDVLS/6LgAEAqlRUAoCA/sABQIBLNf7ANUtLNQFANUsBANog/roAAwBAAAADwAOAAAMAEwAbAAABMycHASEiBhURFBYzITI2NRE0JgMnIwcjEzMTAbiNRkcBiP2ANUtLNQKANUtL5yvIKHPoLuoBgdHRAf9LNf2ANUtLNQKANUv9QHNzAkD9wAAAAAQAPwDAA78C/wAHAAoAaACVAAAlAyMDMzczFycjNwERMDQ1NCYnLgEnLgEnLgEjKgExOAExIgYHBgcGBwYHFT4BNz4BMzoBMzIWFx4BFTAUHQEjJiIjIgYHDgEVHAEVOAEVFBYXHgEXHgEXHgEzOgEzOAExMjY3PgE3FzMnDgEHDgEHKgEjIiYnLgEnLgEnLgE1OAExNDA1NDY3PgE3PgE3PgEzOgE7ARUCQOou6XMpyCtJjEYCgAYFBA8JChcNDh4PAQIKEwoRERAQDwwNHxEQIRACBAIQHgwKC04DBwQfOBgTFwQEAwsHCBMKDBoOAQIBEiIQER8NATtCDR4RDBoOAQEBBw4GBgkEBAUCAgEDAgMIBgYOCAkUCwEBAVPAAj/9wXNzwNH+egEEAgEOGgwLEwgHDAMEBAEBAgQDBAQFOwYKBAQECwkKGg8CASEBEg8OLBoBAgIBCxUKCREHBwsEBAUIBggWDjNoDBYIBwcBAwICBgQECAUFCwUBAQcOBgYLBAUHAgMCQwAAAAcAPwBAA9EDQAAHAAoADgASABYAGgAeAAAlAyMDMzczFycjNyUzESMTFwcnNwcXNwM3JwcXJzcXAkDqLulzKcgrSYxGAcFAQCQttS2tLbUtrS21La0ttS3AAj/9wXNzwNHv/QAC8S21LbUttS390y21LbUttS0AAAEAwABAA0ADQAAqAAABISoBIyIGBw4BBw4BBw4BFRwBFRQWFx4BFx4BFx4BMzoBMxEzETMRMxEzA0D+YAIFAhgsFRMjDw4WCAYHCQcIFw4OIRMVLRgCBAFcgFxoA0AHBgYUDAwdERAiEgIFAhMkEBEdDA0VBwcI/nMCq/1VAqsAAv/xALMEBALcAAUACwAAAS0BJwkBAQ0BFwkBAZ//AAEAUf6jAV0BCQEA/wBQAV3+owEAyMZO/uz+6wHcyMZNARQBFAAGAEAAQAPAA0AAAwAcAB8AIgAyAEIAAAERIREFOgEzMhYXDgEjKgEjKgEjIiYnPgEzOgEzBzcXMTcXASEyFh0BFAYjISImPQE0NhMhMhYdARQGIyEiJj0BNDYBAAIA/qsBAgIVHgMDHhUCAgEBAwEVHwICHxUBAwFcTUh0bf22AwoZIiIZ/PYZIiIZAwoZIiIZ/PYZIiICgP6AAYBKHBQVGxsVFBz2UFCAgAIAIhkKGSIiGQoZIv2AIhkKGSIiGQoZIgAABwBAAIADwAMAAA8AIwAzADcAUABTAFYAAAEzMhYdARQGKwEiJj0BNDYTMzIWHQEUBisBOAExIiY9ATQ2MwEhMhYdARQGIyEiJj0BNDYDESERBTAyMzIWFw4BIyoBMSoBMSImJz4BMzAyMwc3FyM3FwK7yhkiIhnKGSIiGckZIiIZyRgjIhn9wAMKGSIiGfz2GSIiIgHA/tYBARQdAQEdFAEBAQEUHQEBHRQBAVFDQANoYAMAIhkKGSIiGQoZIv8AIhkJGSIiGAoZIv8AIhkKGSIiGQoZIgIA/oABgEocFBQcHBQUHPZQUICAAAAHAEAAgAPAAwAADwAmADYAOgBNAFAAUwAAEzMyFh0BFAYrASImPQE0NhMzMhYdARQwMRQGIzgBMSMiJj0BNDYzESEyFh0BFAYjISImPQE0NgERIREFMDIzMhYXDgEjIiYnPgEzOgEzBzcXJzcXe8oZIiIZyhkiIhnKGSIiGcoZIiIZAwoZIiIZ/PYZIiIBngHA/tYBARQdAQMdFRQdAwEdFAEBAVFEQARlYwMAIhkKGSIiGQoZIv8AIhkJARkiIhkKGSL/ACIZChkiIhkKGSICAP6AAYBKHBQUGxsUFBz2T1ABgIAAAAAABAAAAAAEAAOAAAMAHAAfACIAABMRIREFOgEzMhYXDgEjKgEjKgEjIiYnPgEzOgEzAzcXNRsBAAQA/VQBAQEvQwEBQy8BAQEBAQEvQwEBQy8BAQG3m5Ho2gOA/IADgKxBLy9BQS8uQv3Ft7sEASf+1AAAAAAFAAAAgAQAAwAAEAAkADQANwA7AAATITIWHQEUBiMhIiY9ATQ2MwEhMhYdARQGIyE4ATEiJj0BNDYzESEyFh0BFAYjISImPQE0NicHEQczFSM7A4oZIiIZ/HYZIiIZAcAByRkiIhn+NxgjIhkByhkiIhn+NhkiIqLAgICAAwAiGQoZIiIZChki/wAiGQkZIiIYChki/wAiGQoZIiIZChkiIaEBQIBAAAACAMAAAAOAA4AAGgA1AAAlKgEjIi4CJzQ+AjMyHgIVDgMjKgEjNToBMzI+Ajc0LgIjIg4CFR4DMzoBMwIgAQMBR35eNwFhfHIREXJ8YQE3Xn5HAQMBAQIBNV5HKQFLXlUKClVeSwEpR141AQIBADVdfEdHv614eK2/R0d8XTVVKEZdNTWThV5ehZM1NV1GKAABAbMASAKMAvYAAwAAJRMjAwITeV96SAKu/VIAAQAAAYEEAAIAABMAABMhMhYdARQGIyE4ATEiJj0BNDYzOwOKGSIiGfx2GCMiGQIAIhkJGSIiGAoZIgAAAwAAAL8EAALBACwAMABhAAAlIiYnNzMeATMyFjMyNjcuASMqASMOAQcnNT4BMzI2MzIeAhcOAyMiJiMBIRUhJw4BBycVDgEVFBYXFTMeATMyNjcXFQ4BIyIGIyIuAic+AzMyFjMyFhcHIy4BJwLcKUshAj0TKxcECQRAXggHX0AECQQXLBQ7IEooBAkFNmFKLgQELkphNgUJBP6SASX+20kXLBQ6EhMTEjwTKxcYLBQ7IEooBAkFNmFKLgQELkphNgUJBChLIQI9EysXwBQSWggKAVQ+P1UBCgkBWxEUAShFXjU2XkYoAQFAgNMBCgkBKREtGRotESgICgoJAVsRFAEoRV41Nl5GKAEUEloJCQEAAAAABQAaAIAEAAMAAA8AIwAzADwAYwAAASEyFh0BFAYjISImPQE0NhMhMhYdARQGIyE4ATEiJj0BNDYzESEyFh0BFAYjISImPQE0NgM1Iw4BDwE3FRM1Izc+ATc0NjU0JicuASMiBiM4ATEiBgcOAQcXPgEzMhUOAQ8BFQE7AooZIiIZ/XYZIiIZAooZIiIZ/XYYIyIZAooZIiIZ/XYZIiKdEA4kFAEvVVYvCg0CAQsJCxkOAgICChQICA0EGwUVDCACCwlJAwAiGQoZIiIZChki/wAiGQkZIiIYChki/wAiGQoZIiIZChkiAQjlEBsKJxyl/oAkRw4gEgEBAQwWBwgJAQUGBQ0JFgsOGhAbC2kMAAAFAAAAgAQAAwAAEAAkADQANwA7AAATITIWHQEUBiMhIiY9ATQ2MwEhMhYdARQGIyE4ATEiJj0BNDYzESEyFh0BFAYjISImPQE0NiUXERUzFSM7A4oZIiIZ/HYZIiIZAcAByRkiIhn+NxgjIhkByhkiIhn+NhkiIv4ewICAAwAiGQoZIiIZChki/wAiGQkZIiIYChki/wAiGQoZIiIZChkiIaEBQIBAAAAGAAD/wAQAA8AAEwAnACsALwAzADcAAAEiDgIVFB4CMzI+AjU0LgIDIi4CNTQ+AjMyHgIVFA4CASEVIREhFSEbARcDNxMXAwIAaruLUFCLu2pqu4tQUIu7alCLaTw8aYtQUItpPDxpi/7wAYD+gAGA/oBASjZKSko3SwPAUIu7amq7i1BQi7tqaruLUPyAPGmLUFCLaTw8aYtQUItpPAFAQAEAQP7bAeUb/hsbAeUa/hoAAAAFAAAAgAQAAwAAEAAtAD4AWwBvAAATITIWHQEUBiMhIiY9ATQ2MwEzMjAxMhYVOAExFRQwMRQGIzgBMSMiJj0BNDYzASEyFh0BFAYjISImPQE0NjMBMzIwMTIWFTgBMRUUMDEUBiM4ATEjIiY9ATQ2MzsBMhYdARQGKwE4ATEiJj0BNDYzOwOKGSIiGfx2GSIiGQEACQEZIiIZChkiIhn/AAOKGSIiGfx2GSIiGQHACQEZIiIZChkiIhnACRkiIhkJGCMiGQMAIhkKGSIiGQoZIv8AIhkJARkiIhkKGSL/ACIZChkiIhkKGSIBACIZCQEZIiIZChkiIhkJGSIiGAoZIgAAAAEAwACAA0ADAABBAAA3MDIxMjY1OAExNTQ2MyEHDgEVFBYzMjY3MTc+ATU0Ji8BLgEjIgYVFBYfASE4ATEiDgIVOAExFTgBMRQWMzgBMegBEBhdQwEHhAYGGBAIDwXIBgYGBsgFDwgQGAYGhP74MldBJhcRgBcRoEJehAUOCRAYBwXIBQ8ICA8FyAYGFxEIDgaEJUJXMqARFwAAAAIAQAAAA4ADgAAbADcAAAEHMzIWFRQGKwEiJj0BNDYzMhYdATceARcUNgcBNyMiJjU0NjsBMhYdARQGIyImPQEHLgEnNAY3A4DnRxMaGhOzExoaExIb5hgiBgYG/MDnRxMaGhOzExoaExIb5hgiBgYGA0DmGxITGhoTsxMaGhNH5wUjFwoPBv0A5hsSExoaE7MTGhoTR+cFIxcKDwYAAAABAIAAPgN/A0AAowAAJSIjBz4BNz4BNz4BNz4BNTwBNTwBNTQmJy4BJy4BJy4BIyoBIyoBIyIGBw4BBw4BBw4BFRwBFTgBMRQWFx4BFx4BFx4BFyciKwEVMBQxFBYXHgEzOgExITUuAScuAScuAScuATU8ATE8ATU0Njc+ATc+ATc+ATMyFhceARceARceARUcARUwFBUUBgcOAQcOAQcOAQ8BIToBMTI2Nz4BNTA0MTUC9hcXLRksFBMiDw4XCAgJEA8OKBgaOiAiSSYBAgEBAgEmSSIhOxkZKA4OEAkICBcPDiITFCwXKxcWigYGBQ8IAQEBGRUmEBIdDA0VBwcICwoKGxERJxYWMhkaMRgVKBERGwkKCwgHBxQNDB4RESUVAQEZAQEJDgYFBqgFCRgPDyQUFS4YGjYcAQEBAQEBJkcgHzcXFiMMDA4ODQwkFxc3HyBHJgECAR03GhkuFBQkDw8YCQVAAQgOBQUGkQMQDAweERIpFxcyGgEBAQMBHDQYFiYPDxcICAgICAgXDw8mFhg0HAEDAQEBGjIYFikSER4MDA8EjwYFBQ4IAUAAAAACARUAFgPpAp0ACwA1AAAlJzcjBycjFwczNxcFNSM3PgE3PAE1NCYnLgEjKgEjMCIjIgYHDgEHFz4BNz4BMzIVDgEPARUCzLurXXVqXZ2rYXKAAYGPUhAVAxANECcVAgQCAQEQHQ0LEQQfBQ0ICBMLOQMSD3PI8OWhoeXwq6uwLYAWNB0CAwETIQwLDQgHBhQMGwkNBQUGMxowE7AKAAAAAgEVAMgD6QONAAsANQAAJSc3IwcnIxcHMzcXATUjNz4BNzwBNTQmJy4BIyoBIyoBIyIGBw4BBxc+ATc+ATcyFQ4BDwEVAsy7q111al2dq2FygAGBj1IQFQMQDREoFgEDAQEBARAdDQsRBCAEDQgIFAo5AhMPcsjw5aGh5fCrqwFQLYAWNB0CAwETIQwNDggHBhQMGwgOBQUFATMbLxSwCgAAAAAGAEAAQAPAAwAAAwAHAAsADwATABcAABMhFSElIRUhBSEVISUhFSEFIRUhJSEVIUABov5eAd4Bov5e/iIBov5eAd4Bov5e/iIBov5eAd4Bov5eAwDAwMBAwMDAQMDAwAACAIAAQQOAA0AALQBbAAABMhYVMBQVFAYHNQchMhYVFAYjIRceARUcATEUBiMiJic1Jy4BNTQ2NzE3PgEzATEXHgEVFAYHMQcOASMiJjUwNDE0NjcxNyEGJjU0NjMhJy4BNTwBMTQ2MzIWFwEQFBwIBg4CLBQcHBT91A4HBxwUCxEGYAYICAZgBhELAgBgBwcHB2AGEQsUHAgGDv3WFBwcFAIsDgcHHBQLEQYDQCYaAQEMFgoBEyYaGiYTCRYMAQEaJgoIAYAJFw0MFwqACAv+bYAJFw0MFwqACAolGwENFgkTASYaGiYTCRYMAQEaJgoIAAAABAEAAIADAQMAAAMABwALAA8AAAEnNxcXNycHAwcXNzcXBycBKSnrKcMq7CnDKespwyrsKQIAJ9km2ibaJv6mJton2SfZJwAAAgDQ/8ADEAMOADIANgAAARwBFRQWFx4BMzI2MzoBMzI2Nz4BNTwBNREjERwBFRQGBw4BIyoBIyoBIyImNTQ2NREjAzUhFQESHxseSyoFCgUCBwMsTR8cIVgUERIxGwIEAgIDAzVLAVhCAkABTAMHAylJGhgcAR0aGkgqAwYDAb/+RgEEAhsvEhEUSzUCAwIBtvy3ODgAAAABAMAAgANAAwAAMAAAJSImPQE0JiMhFx4BFRQGIyImJzEnLgE1NDY/AT4BMzIWFRQGBzEHITIeAh0BFAYjAxgQF15C/veEBgYYEAgPBcgGBgYGyAUPCBAYBgaEAQgyV0EmFxGAFxGgQl6EBQ4JEBgHBcgFDwgIDwXIBgYXEQgOBoQmQVgxoBEXAAAAAAYAAACABAADAAAPACMAMwBDAGAAcAAAEyEyFh0BFAYjISImPQE0NhMhMhYdARQGIyE4ATEiJj0BNDYzESEyFh0BFAYjISImPQE0NiMzMhYdARQGKwEiJj0BNDYTMzIwMTIWFTgBMRUUMDEUBiM4ATEjIiY9ATQ2MxEzMhYdARQGKwEiJj0BNDb7AsoZIiIZ/TYZIiIZAsoZIiIZ/TYYIyIZAsoZIiIZ/TYZIiKnChkiIhkKGSIiGQkBGSIiGQoZIiIZChkiIhkKGSIiAwAiGQoZIiIZChki/wAiGQkZIiIYChki/wAiGQoZIiIZChkiIhkKGSIiGQoZIgEAIhkJARkiIhkKGSIBACIZChkiIhkKGSIAAAQAAABABAADQAAXACcASABLAAABISIOAhURFB4CMyEyPgI1ETQuAhMUBiMhIiY1ETQ2MyEyFhUFMQcOASMwIjEqASMiJic1PgEzOgEzMhYXIxceARUUBgcnNycDAP4ANV1GKChGXTUCADVdRigoRl1LSzX+ADVLSzUCADVL/umaBg0IAQECARIbAgIbEgECAQgOBwGaCg0NCoAICwNAKEZdNf8ANV1GKChGXTUBADVdRij+ADVLSzUBADVLSzWjVgMEGRKqEhkEBFUEEwwLEwQdBQYAAQAAAAEAAL19wCtfDzz1AAsEAAAAAADUtozhAAAAANS2jOH/8f/ABAQDwAAAAAgAAgAAAAAAAAABAAADwP/AAAAEAP/x//wEBAABAAAAAAAAAAAAAAAAAAAALAQAAAAAAAAAAAAAAAIAAAAEAAAABAAAAAQAAAAEAAEZBAAAwAQAAEAEAABABAAAgAQAAEAEAABABAAAQAQAAD8EAAA/BAAAwAQA//EEAABABAAAQAQAAEAEAAAABAAAAAQAAMAEAAGzBAAAAAQAAAAEAAAaBAAAAAQAAAAEAAAABAAAwAQAAEAEAACABAABFQQAARUEAABABAAAgAQAAQAEAADQBAAAwAQAAAAEAAAAAAAAAAAKABQAHgBmALAA+AFeAagCBAJqAwADTgOAA7IEeAS0BPQFFgV4Be4GYgacBvAHOAdGB2QH7gh2CMoJJAmmCfQKRAscC2wLvgvuDGgMjAzYDR4NqA4SAAAAAQAAACwApAAHAAAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAA4ArgABAAAAAAABAAgAAAABAAAAAAACAAcAaQABAAAAAAADAAgAOQABAAAAAAAEAAgAfgABAAAAAAAFAAsAGAABAAAAAAAGAAgAUQABAAAAAAAKABoAlgADAAEECQABABAACAADAAEECQACAA4AcAADAAEECQADABAAQQADAAEECQAEABAAhgADAAEECQAFABYAIwADAAEECQAGABAAWQADAAEECQAKADQAsFJlZGFjdG9yAFIAZQBkAGEAYwB0AG8AclZlcnNpb24gMS4wAFYAZQByAHMAaQBvAG4AIAAxAC4AMFJlZGFjdG9yAFIAZQBkAGEAYwB0AG8AclJlZGFjdG9yAFIAZQBkAGEAYwB0AG8AclJlZ3VsYXIAUgBlAGcAdQBsAGEAclJlZGFjdG9yAFIAZQBkAGEAYwB0AG8AckZvbnQgZ2VuZXJhdGVkIGJ5IEljb01vb24uAEYAbwBuAHQAIABnAGUAbgBlAHIAYQB0AGUAZAAgAGIAeQAgAEkAYwBvAE0AbwBvAG4ALgAAAAMAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=") format("truetype");
  font-weight: normal;
  font-style: normal; }

[class^="re-icon-"], [class*=" re-icon-"] {
  /* use !important to prevent issues with browser extensions that change fonts */
  font-family: 'Redactor' !important;
  speak: none;
  font-style: normal;
  font-weight: normal;
  font-variant: normal;
  text-transform: none;
  line-height: 1;
  -webkit-font-smoothing: antialiased;
  -moz-osx-font-smoothing: grayscale; }

.re-icon-aligncenter:before {
  content: "\e900"; }

.re-icon-alignment:before,
.re-icon-alignleft:before {
  content: "\e901"; }

.re-icon-alignright:before {
  content: "\e902"; }

.re-icon-bold:before {
  content: "\e903"; }

.re-icon-bookmark:before {
  content: "\e904"; }

.re-icon-clips:before {
  content: "\e905"; }

.re-icon-codesnippets:before {
  content: "\e906"; }

.re-icon-deleted:before {
  content: "\e907"; }

.re-icon-expand:before {
  content: "\e908"; }

.re-icon-file:before {
  content: "\e909"; }

.re-icon-fontcolor:before {
  content: "\e90a"; }

.re-icon-fontfamily:before {
  content: "\e90b"; }

.re-icon-fontsize:before {
  content: "\e90c"; }

.re-icon-format:before {
  content: "\e90d"; }

.re-icon-html:before {
  content: "\e90e"; }

.re-icon-imagecenter:before {
  content: "\e90f"; }

.re-icon-imageleft:before {
  content: "\e910"; }

.re-icon-imageright:before {
  content: "\e911"; }

.re-icon-image:before {
  content: "\e912"; }

.re-icon-indent:before {
  content: "\e913"; }

.re-icon-inline:before {
  content: "\e914"; }

.re-icon-italic:before {
  content: "\e915"; }

.re-icon-horizontalrule:before {
  content: "\e916"; }

.re-icon-link:before {
  content: "\e917"; }

.re-icon-ol:before,
.re-icon-ordered:before {
  content: "\e918"; }

.re-icon-outdent:before {
  content: "\e919"; }

.re-icon-properties:before {
  content: "\e91a"; }

.re-icon-readmore:before {
  content: "\e91b"; }

.re-icon-redo:before {
  content: "\e91c"; }

.re-icon-retract:before {
  content: "\e91d"; }

.re-icon-specialcharacters:before {
  content: "\e91e"; }

.re-icon-sub:before {
  content: "\e91f"; }

.re-icon-sup:before {
  content: "\e920"; }

.re-icon-table:before {
  content: "\e921"; }

.re-icon-textdirection:before {
  content: "\e922"; }

.re-icon-toggle:before {
  content: "\e923"; }

.re-icon-underline:before {
  content: "\e924"; }

.re-icon-undo:before {
  content: "\e925"; }

.re-icon-ul:before,
.re-icon-lists:before,
.re-icon-unordered:before {
  content: "\e926"; }

.re-icon-video:before {
  content: "\e927"; }

.redactor-box {
  position: relative;
  overflow: visible; }

.redactor-layer,
.redactor-box {
  background: #fff; }

.redactor-layer,
.redactor-box,
.redactor-box textarea {
  z-index: auto; }

.redactor-link-tooltip {
  z-index: 99; }

.redactor-toolbar {
  z-index: 100; }

.redactor-box-fullscreen {
  z-index: 1051; }

.redactor-air,
.redactor-dropdown {
  z-index: 1052; }

#redactor-modal-overlay,
#redactor-modal-box,
#redactor-modal {
  z-index: 1053; }

.redactor-body-fullscreen .redactor-link-tooltip {
  z-index: 1099; }

.redactor-box-fullscreen {
  position: fixed;
  top: 0;
  left: 0;
  width: 100%; }

.redactor-placeholder:after {
  position: absolute;
  top: 20px;
  left: 20px;
  content: attr(placeholder);
  display: block;
  color: rgba(0, 0, 0, 0.3);
  font-weight: normal !important; }

.redactor-layer {
  position: relative;
  overflow: auto;
  margin: 0;
  padding: 24px 20px;
  padding-top: 20px;
  outline: none;
  white-space: normal;
  border: 1px solid rgba(0, 0, 0, 0.07); }

.redactor-relative {
  position: relative; }

.redactor-in {
  cursor: text; }

.redactor-layer:focus,
.redactor-in:focus {
  outline: none; }

.redactor-scrollbar-measure {
  position: absolute;
  top: -9999px;
  width: 50px;
  height: 50px;
  overflow: scroll; }

.redactor-script-tag {
  display: none; }

.redactor-layer-img-edit img {
  cursor: pointer; }

.redactor-voice-label {
  display: none; }

.redactor-voice-alert {
  position: absolute;
  left: -3000px; }

.redactor-toolbar {
  position: relative;
  padding: 0 !important;
  background: #fff;
  border: none;
  box-shadow: 0 1px 2px rgba(0, 0, 0, 0.25); }

.redactor-toolbar:after {
  content: "";
  display: table;
  clear: both; }

.redactor-toolbar li a {
  color: rgba(0, 0, 0, 0.8); }

.redactor-toolbar li a:hover {
  outline: none;
  background-color: #3d79f2;
  color: #fff; }

.redactor-toolbar li a:active, .redactor-toolbar li a.redactor-act {
  outline: none;
  background-color: #eee;
  color: #444; }

.redactor-toolbar li a.redactor-button-disabled {
  opacity: 0.3; }

.redactor-toolbar li a.redactor-button-disabled:hover {
  color: #333;
  outline: none;
  background-color: transparent !important;
  cursor: default; }

.redactor-toolbar li a.redactor-button-focus {
  color: #fff;
  background: #000; }

.redactor-toolbar.redactor-toolbar-external {
  z-index: 999;
  border: 1px solid rgba(0, 0, 0, 0.1);
  box-shadow: none; }

.redactor-air {
  position: absolute;
  background: rgba(0, 0, 0, 0.9);
  padding: 0;
  max-width: 576px;
  min-width: 200px;
  border-radius: 4px;
  border: none; }

.redactor-air li a {
  color: rgba(255, 255, 255, 0.75); }

.redactor-air li a:hover {
  outline: none;
  background-color: #1f78d8;
  color: #fff; }

.redactor-air li a:active, .redactor-air li a.redactor-act {
  outline: none;
  background-color: #333;
  color: rgba(255, 255, 255, 0.5); }

.redactor-air li a.redactor-button-disabled {
  opacity: .3; }

.redactor-air li a.redactor-button-disabled:hover {
  color: rgba(255, 255, 255, 0.3);
  outline: none;
  background-color: transparent !important;
  cursor: default; }

.redactor-air li a.redactor-button-focus {
  color: #333;
  background: #eee; }

.redactor-air,
.redactor-toolbar {
  font-family: "Trebuchet MS", "Helvetica Neue", Helvetica, Tahoma, sans-serif;
  margin: 0 !important;
  list-style: none !important;
  line-height: 1 !important; }

.redactor-air li,
.redactor-toolbar li {
  vertical-align: top;
  display: inline-block;
  margin: 0 !important;
  padding: 0 !important;
  outline: none;
  list-style: none !important; }

.redactor-air li a,
.redactor-toolbar li a {
  box-sizing: border-box;
  font-size: 14px;
  display: block;
  text-align: center;
  line-height: 48px;
  height: 48px;
  padding: 16px;
  padding-top: 17px;
  padding-bottom: 15px;
  cursor: pointer;
  outline: none;
  border: none;
  line-height: 1;
  text-decoration: none;
  cursor: pointer;
  zoom: 1;
  position: relative; }

.redactor-air li a.re-button-icon,
.redactor-toolbar li a.re-button-icon {
  padding: 16px;
  font-size: 16px; }

.redactor-air li a .re-button-tooltip,
.redactor-toolbar li a .re-button-tooltip {
  display: none;
  position: absolute;
  white-space: nowrap;
  left: 50%;
  bottom: -18px;
  background: rgba(0, 0, 0, 0.9);
  border-radius: 2px;
  padding: 3px 8px;
  color: rgba(255, 255, 255, 0.8);
  font-size: 12px;
  font-family: Consolas, Menlo, Monaco, "Courier New", monospace; }

.redactor-toolbar li a {
  border-right: 1px solid rgba(0, 0, 0, 0.05); }

.redactor-toolbar li:last-child a {
  border-right: none; }

.redactor-link-tooltip {
  border-radius: 3px;
  font-family: "Trebuchet MS", "Helvetica Neue", Helvetica, Tahoma, sans-serif;
  position: absolute;
  padding: 16px;
  line-height: 1;
  display: inline-block;
  background-color: rgba(0, 0, 0, 0.95);
  color: #555 !important;
  font-size: 14px; }

.redactor-link-tooltip a {
  font-size: 14px;
  color: #ccc;
  margin: 0 8px;
  text-decoration: none; }

.redactor-link-tooltip a:hover {
  color: #fff; }

.redactor-structure h1, .redactor-structure h2, .redactor-structure h3, .redactor-structure h4, .redactor-structure h5, .redactor-structure h6, .redactor-structure div {
  position: relative; }

.redactor-structure h1:before, .redactor-structure h2:before, .redactor-structure h3:before, .redactor-structure h4:before, .redactor-structure h5:before, .redactor-structure h6:before, .redactor-structure div:before {
  width: 24px;
  position: absolute;
  font-size: 10px;
  font-weight: normal;
  opacity: .3;
  left: -28px;
  text-align: right; }

.redactor-structure h1:before {
  content: "h1"; }

.redactor-structure h2:before {
  content: "h2"; }

.redactor-structure h3:before {
  content: "h3"; }

.redactor-structure h4:before {
  content: "h4"; }

.redactor-structure h5:before {
  content: "h5"; }

.redactor-structure h6:before {
  content: "h6"; }

.redactor-structure div:before {
  content: "div"; }

#redactor-image-box {
  position: relative;
  max-width: 100%;
  display: inline-block;
  line-height: 0;
  outline: 3px solid #1f78d8;
  box-shadow: 0 0 12px #1f78d8; }

#redactor-image-editter {
  position: absolute;
  z-index: 5;
  top: 50%;
  left: 50%;
  margin-top: -11px;
  margin-left: -18px;
  line-height: 1;
  background-color: rgba(0, 0, 0, 0.9);
  border-radius: 3px;
  color: #fff;
  font-size: 12px;
  padding: 7px 10px;
  cursor: pointer; }

#redactor-image-resizer {
  box-sizing: border-box;
  position: absolute;
  z-index: 2;
  line-height: 1;
  cursor: nw-resize;
  bottom: -5px;
  right: -6px;
  border: 2px solid #000;
  background-color: rgba(255, 255, 255, 0.9);
  width: 10px;
  height: 10px; }

#redactor-droparea {
  position: relative;
  overflow: hidden;
  padding: 64px 24px;
  border: 3px dashed rgba(0, 0, 0, 0.1); }

#redactor-droparea.drag-hover {
  background: rgba(200, 222, 250, 0.75); }

#redactor-droparea.drag-drop {
  background: rgba(250, 248, 200, 0.5); }

#redactor-droparea-placeholder {
  text-align: center;
  font-size: 12px;
  margin-left: 64px;
  color: rgba(0, 0, 0, 0.7); }

.redactor-image-dragover {
  outline: 2px solid #3d79f2; }

#redactor-progress {
  position: fixed;
  top: 0;
  left: 0;
  width: 100%;
  z-index: 1000000;
  height: 10px; }

#redactor-progress span {
  background-image: -webkit-linear-gradient(45deg, rgba(255, 255, 255, 0.2) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.2) 50%, rgba(255, 255, 255, 0.2) 75%, transparent 75%, transparent);
  background-image: -o-linear-gradient(45deg, rgba(255, 255, 255, 0.2) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.2) 50%, rgba(255, 255, 255, 0.2) 75%, transparent 75%, transparent);
  background-image: linear-gradient(45deg, rgba(255, 255, 255, 0.2) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.2) 50%, rgba(255, 255, 255, 0.2) 75%, transparent 75%, transparent);
  -webkit-animation: progress-bar-stripes 2s linear infinite;
  -o-animation: progress-bar-stripes 2s linear infinite;
  animation: progress-bar-stripes 2s linear infinite;
  display: block;
  width: 100%;
  height: 100%;
  background-color: #3d58a8;
  background-size: 40px 40px; }

@-webkit-keyframes progress-bar-stripes {
  from {
    background-position: 40px 0; }
  to {
    background-position: 0 0; } }

@-o-keyframes progress-bar-stripes {
  from {
    background-position: 40px 0; }
  to {
    background-position: 0 0; } }

@keyframes progress-bar-stripes {
  from {
    background-position: 40px 0; }
  to {
    background-position: 0 0; } }

.redactor-animated {
  -webkit-animation-duration: 1s;
  animation-duration: 1s;
  -webkit-animation-fill-mode: both;
  animation-fill-mode: both; }

@-webkit-keyframes redactorSlideUp {
  to {
    padding-top: 0;
    padding-bottom: 0;
    height: 0; } }

@keyframes redactorSlideUp {
  to {
    padding-top: 0;
    padding-bottom: 0;
    height: 0; } }

.redactor-slideUp {
  overflow: hidden;
  -webkit-animation-name: redactorSlideUp;
  animation-name: redactorSlideUp; }

@-webkit-keyframes redactorSlideDown {
  from {
    height: 0;
    padding-top: 0;
    padding-bottom: 0; } }

@keyframes redactorSlideDown {
  from {
    height: 0;
    padding-top: 0;
    padding-bottom: 0; } }

.redactor-slideDown {
  overflow: hidden;
  -webkit-animation-name: redactorSlideDown;
  animation-name: redactorSlideDown; }

@-webkit-keyframes redactorFadeIn {
  from {
    opacity: 0; }
  to {
    opacity: 1; } }

@keyframes redactorFadeIn {
  from {
    opacity: 0; }
  to {
    opacity: 1; } }

.redactor-fadeIn {
  -webkit-animation-name: redactorFadeIn;
  animation-name: redactorFadeIn; }

@-webkit-keyframes redactorFadeOut {
  from {
    opacity: 1; }
  to {
    opacity: 0; } }

@keyframes redactorFadeOut {
  from {
    opacity: 1; }
  to {
    opacity: 0; } }

.redactor-fadeOut {
  -webkit-animation-name: redactorFadeOut;
  animation-name: redactorFadeOut; }

.redactor-dropdown {
  font-family: "Trebuchet MS", "Helvetica Neue", Helvetica, Tahoma, sans-serif;
  min-width: 220px;
  max-height: 254px;
  color: #000;
  margin: 0;
  padding: 0;
  font-size: 14px;
  background: #fff;
  box-shadow: 0 5px 20px rgba(0, 0, 0, 0.2);
  overflow: auto;
  list-style: none; }

.redactor-dropdown li {
  border-bottom: 1px solid rgba(0, 0, 0, 0.07); }

.redactor-dropdown li:last-child {
  border-bottom: none; }

.redactor-dropdown li:hover {
  background-color: #3d79f2; }

.redactor-dropdown li:hover a {
  color: #fff !important;
  text-decoration: none; }

.redactor-dropdown li.redactor-dropdown-link-inactive {
  background: none; }

.redactor-dropdown li.redactor-dropdown-link-inactive a,
.redactor-dropdown li.redactor-dropdown-link-inactive a:hover {
  background: none;
  cursor: default;
  color: #000 !important;
  opacity: 0.4;
  background: none; }

.redactor-dropdown a {
  display: block;
  padding: 12px 10px;
  color: #000;
  text-decoration: none; }

.redactor-dropdown a span {
  padding: 2px 4px 1px 4px;
  display: inline-block;
  border-radius: 3px;
  line-height: 1; }

.redactor-dropdown a:focus {
  outline: none; }

.redactor-dropdown a.selected {
  background-color: #000;
  color: #fff; }

.redactor-dropdown a.redactor-dropdown-link-selected {
  color: #fff;
  background: #000; }

.redactor-dropdown-box-inline .redactor-dropdown-marked span {
  background-color: #ffd61e;
  color: #000;
  text-decoration: none; }

.redactor-dropdown-box-inline .redactor-dropdown-code span {
  font-family: Consolas, Menlo, Monaco, "Courier New", monospace;
  background: rgba(0, 0, 0, 0.05); }

.redactor-dropdown-box-inline .redactor-dropdown-sample span {
  font-family: Consolas, Menlo, Monaco, "Courier New", monospace;
  background: #46a9fc;
  color: rgba(255, 255, 255, 0.9); }

.redactor-dropdown-box-inline .redactor-dropdown-variable span {
  font-family: Consolas, Menlo, Monaco, "Courier New", monospace;
  color: rgba(0, 0, 0, 0.5); }

.redactor-dropdown-box-inline .redactor-dropdown-shortcut span {
  font-family: Consolas, Menlo, Monaco, "Courier New", monospace;
  background: #000;
  color: rgba(255, 255, 255, 0.85);
  white-space: nowrap; }

.redactor-dropdown-box-inline .redactor-dropdown-cite span {
  color: rgba(0, 0, 0, 0.5);
  font-style: italic; }

.redactor-dropdown-box-inline .redactor-dropdown-sup span,
.redactor-dropdown-box-inline .redactor-dropdown-sub span {
  font-size: 12px; }

.redactor-dropdown-box-format .redactor-dropdown-blockquote {
  color: rgba(0, 0, 0, 0.4);
  font-style: italic; }

.redactor-dropdown-box-format .redactor-dropdown-pre {
  font-family: monospace, sans-serif; }

.redactor-dropdown-box-format .redactor-dropdown-h1,
.redactor-dropdown-box-format .redactor-dropdown-h2,
.redactor-dropdown-box-format .redactor-dropdown-h3,
.redactor-dropdown-box-format .redactor-dropdown-h4,
.redactor-dropdown-box-format .redactor-dropdown-h5,
.redactor-dropdown-box-format .redactor-dropdown-h6 {
  line-height: 24px;
  font-weight: bold; }

.redactor-dropdown-box-format .redactor-dropdown-h1 {
  font-size: 40px;
  line-height: 32px; }

.redactor-dropdown-box-format .redactor-dropdown-h2 {
  font-size: 32px;
  line-height: 32px; }

.redactor-dropdown-box-format .redactor-dropdown-h3 {
  font-size: 24px; }

.redactor-dropdown-box-format .redactor-dropdown-h4 {
  font-size: 21px; }

.redactor-dropdown-box-format .redactor-dropdown-h5 {
  font-size: 18px; }

.redactor-dropdown-box-format .redactor-dropdown-h6 {
  font-size: 16px; }

#redactor-modal-overlay {
  position: fixed;
  top: 0;
  left: 0;
  margin: auto;
  overflow: auto;
  width: 100%;
  height: 100%;
  background-color: rgba(255, 255, 255, 0.95); }

#redactor-modal-box {
  position: fixed;
  top: 0;
  left: 0;
  bottom: 0;
  right: 0;
  overflow-x: hidden;
  overflow-y: auto; }

#redactor-modal {
  position: relative;
  margin: auto;
  margin-top: 16px;
  padding: 0;
  background: #fff;
  color: #000;
  border-radius: 5px;
  box-shadow: 0 4px 40px rgba(0, 0, 0, 0.15);
  font-family: "Trebuchet MS", "Helvetica Neue", Helvetica, Tahoma, sans-serif;
  font-size: 14px; }

@media (max-width: 768px) {
  #redactor-modal {
    font-size: 16px !important; } }

#redactor-modal #redactor-modal-header {
  border-top-right-radius: 5px;
  border-top-left-radius: 5px;
  padding: 20px;
  font-size: 18px;
  font-weight: bold;
  color: #000;
  border-bottom: 1px solid rgba(0, 0, 0, 0.05); }

#redactor-modal #redactor-modal-close {
  position: absolute;
  top: 10px;
  right: 4px;
  width: 30px;
  height: 40px;
  text-align: center;
  color: rgba(0, 0, 0, 0.3);
  font-size: 30px;
  font-weight: 300;
  cursor: pointer;
  -webkit-appearance: none;
  padding: 0;
  border: 0;
  background: none;
  outline: none; }

#redactor-modal #redactor-modal-close:hover {
  color: #000; }

#redactor-modal #redactor-modal-body {
  overflow: auto;
  padding: 40px 48px 24px 48px; }

#redactor-modal #redactor-modal-body section {
  margin-bottom: 24px; }

#redactor-modal #redactor-modal-body label {
  font-weight: normal;
  font-size: 15px;
  display: block;
  margin-bottom: 4px;
  color: rgba(0, 0, 0, 0.8); }

#redactor-modal #redactor-modal-body label .desc {
  color: rgba(0, 0, 0, 0.5); }

#redactor-modal #redactor-modal-body label.checkbox {
  font-size: inherit; }

@media (max-width: 768px) {
  #redactor-modal #redactor-modal-body {
    padding: 24px; } }

#redactor-modal select,
#redactor-modal input[type="text"],
#redactor-modal input[type="password"],
#redactor-modal input[type="email"],
#redactor-modal input[type="url"],
#redactor-modal input[type="number"],
#redactor-modal textarea {
  box-sizing: border-box;
  position: relative;
  z-index: 2;
  margin: 0;
  padding: 8px;
  height: 40px;
  border: 1px solid #ddd;
  border-radius: 3px;
  background-color: white;
  box-shadow: none;
  color: #333;
  width: 100%;
  font-size: 16px;
  font-family: "Trebuchet MS", "Helvetica Neue", Helvetica, Tahoma, sans-serif; }

#redactor-modal select:focus,
#redactor-modal input[type="text"]:focus,
#redactor-modal input[type="password"]:focus,
#redactor-modal input[type="email"]:focus,
#redactor-modal input[type="url"]:focus,
#redactor-modal input[type="number"]:focus,
#redactor-modal textarea:focus {
  -moz-transition: border 0.3s ease-in;
  transition: border 0.3s ease-in;
  outline: none;
  border-color: #1f78d8; }

#redactor-modal textarea {
  display: block;
  line-height: 1.4em; }

#redactor-modal button {
  padding: 0 20px;
  margin: 0;
  margin-bottom: 8px;
  margin-right: 8px;
  height: 40px;
  line-height: 38px;
  outline: none;
  border: 2px solid transparent;
  border-radius: 3px;
  background-color: #eee;
  color: #000;
  text-align: center;
  text-decoration: none;
  font-weight: normal;
  font-size: 15px;
  font-family: "Trebuchet MS", "Helvetica Neue", Helvetica, Tahoma, sans-serif;
  cursor: pointer;
  vertical-align: middle;
  -webkit-appearance: none; }

#redactor-modal button:hover {
  color: #777;
  background: none;
  background-color: #f5f5f5;
  text-decoration: none; }

#redactor-modal button.redactor-modal-button-offset {
  margin-left: 24px; }

#redactor-modal button#redactor-modal-button-delete {
  background: none;
  border-color: #f23d3d;
  color: #f23d3d; }

#redactor-modal button#redactor-modal-button-delete:hover {
  color: rgba(255, 255, 255, 0.6);
  background-color: #f23d3d; }

#redactor-modal button#redactor-modal-button-action {
  background: none;
  color: #fff;
  background-color: #1c86f2; }

#redactor-modal button#redactor-modal-button-action:hover {
  color: rgba(255, 255, 255, 0.6);
  background-color: #4ca0f5; }

#redactor-modal .redactor-group:after {
  content: "";
  display: table;
  clear: both; }

#redactor-modal .redactor-modal-tab-side {
  float: left;
  width: 26%;
  margin-right: 6%; }

#redactor-modal .redactor-modal-tab-area {
  float: left;
  width: 66%; }

@media (max-width: 768px) {
  #redactor-modal .redactor-modal-tab-side {
    float: none;
    width: auto;
    margin-right: 0;
    margin-bottom: 24px; }
  #redactor-modal .redactor-modal-tab-area {
    float: none;
    width: auto; } }

#redactor-modal-tabber {
  margin-bottom: 40px;
  font-size: 12px; }

#redactor-modal-tabber a {
  border: 1px solid #ddd;
  line-height: 1;
  padding: 8px 15px;
  margin-right: -1px;
  text-decoration: none;
  color: #000; }

#redactor-modal-tabber a:hover {
  background-color: #1f78d8;
  border-color: #1f78d8;
  color: #fff; }

#redactor-modal-tabber a.active {
  cursor: default;
  background-color: rgba(0, 0, 0, 0.05);
  border-color: #ddd;
  color: rgba(0, 0, 0, 0.5); }

#redactor-modal-list {
  margin-left: 0;
  padding-left: 0;
  list-style: none;
  max-height: 250px;
  overflow-x: auto; }

#redactor-modal-list li {
  border-bottom: 1px solid rgba(0, 0, 0, 0.07); }

#redactor-modal-list li:last-child {
  border-bottom: none; }

#redactor-modal-list a {
  padding: 16px 4px;
  color: #000;
  text-decoration: none;
  font-size: 15px;
  display: block;
  position: relative; }

#redactor-modal-list a:hover {
  background-color: #eee; }

.redactor-styles {
  font-family: "Trebuchet MS", "Helvetica Neue", Helvetica, Tahoma, sans-serif;
  font-size: 16px;
  line-height: 24px;
  color: #333; }

.redactor-styles[dir="rtl"] {
  direction: rtl;
  unicode-bidi: embed; }

.redactor-styles[dir="rtl"] ul li,
.redactor-styles[dir="rtl"] ol li {
  text-align: right; }

.redactor-styles[dir="rtl"] ul,
.redactor-styles[dir="rtl"] ol,
.redactor-styles[dir="rtl"] ul ul,
.redactor-styles[dir="rtl"] ol ol,
.redactor-styles[dir="rtl"] ul ol,
.redactor-styles[dir="rtl"] ol ul {
  margin: 0 24px 0 0; }

@media (max-width: 768px) {
  .redactor-styles {
    font-size: 16px; } }

.redactor-styles a {
  color: #256bc9; }

.redactor-styles a:focus, .redactor-styles a:hover {
  color: #e21e3b; }

.redactor-styles h1,
.redactor-styles h2,
.redactor-styles h3,
.redactor-styles h4,
.redactor-styles h5,
.redactor-styles h6 {
  font-family: "Trebuchet MS", "Helvetica Neue", Helvetica, Tahoma, sans-serif;
  font-weight: bold;
  color: #222;
  text-rendering: optimizeLegibility;
  margin: 0;
  padding: 0;
  margin-bottom: 12px; }

.redactor-styles h1:empty,
.redactor-styles h2:empty,
.redactor-styles h3:empty,
.redactor-styles h4:empty,
.redactor-styles h5:empty,
.redactor-styles h6:empty {
  min-height: 24px; }

.redactor-styles h1 {
  font-size: 40px;
  line-height: 44px; }

.redactor-styles h2 {
  font-size: 32px;
  line-height: 36px; }

.redactor-styles h3 {
  font-size: 24px;
  line-height: 32px; }

.redactor-styles h4 {
  font-size: 21px;
  line-height: 24px; }

.redactor-styles h5 {
  font-size: 18px;
  line-height: 24px; }

.redactor-styles h6 {
  font-size: 16px;
  line-height: 24px; }

.redactor-styles p,
.redactor-styles ul,
.redactor-styles ol,
.redactor-styles dl,
.redactor-styles blockquote,
.redactor-styles hr,
.redactor-styles pre,
.redactor-styles table,
.redactor-styles figure,
.redactor-styles address {
  padding: 0;
  margin: 0; }

.redactor-styles p:empty,
.redactor-styles blockquote:empty {
  min-height: 24px; }

.redactor-styles p + h2,
.redactor-styles p + h3,
.redactor-styles p + h4,
.redactor-styles p + h5,
.redactor-styles p + h6,
.redactor-styles ul + h2,
.redactor-styles ul + h3,
.redactor-styles ul + h4,
.redactor-styles ul + h5,
.redactor-styles ul + h6,
.redactor-styles ol + h2,
.redactor-styles ol + h3,
.redactor-styles ol + h4,
.redactor-styles ol + h5,
.redactor-styles ol + h6,
.redactor-styles dl + h2,
.redactor-styles dl + h3,
.redactor-styles dl + h4,
.redactor-styles dl + h5,
.redactor-styles dl + h6,
.redactor-styles blockquote + h2,
.redactor-styles blockquote + h3,
.redactor-styles blockquote + h4,
.redactor-styles blockquote + h5,
.redactor-styles blockquote + h6,
.redactor-styles hr + h2,
.redactor-styles hr + h3,
.redactor-styles hr + h4,
.redactor-styles hr + h5,
.redactor-styles hr + h6,
.redactor-styles pre + h2,
.redactor-styles pre + h3,
.redactor-styles pre + h4,
.redactor-styles pre + h5,
.redactor-styles pre + h6,
.redactor-styles table + h2,
.redactor-styles table + h3,
.redactor-styles table + h4,
.redactor-styles table + h5,
.redactor-styles table + h6,
.redactor-styles form + h2,
.redactor-styles form + h3,
.redactor-styles form + h4,
.redactor-styles form + h5,
.redactor-styles form + h6,
.redactor-styles figure + h2,
.redactor-styles figure + h3,
.redactor-styles figure + h4,
.redactor-styles figure + h5,
.redactor-styles figure + h6 {
  margin-top: 24px; }

.redactor-styles ul,
.redactor-styles ol,
.redactor-styles ul ul,
.redactor-styles ol ol,
.redactor-styles ul ol,
.redactor-styles ol ul {
  margin: 0 0 0 24px; }

.redactor-styles ul li,
.redactor-styles ol li {
  text-align: left; }

.redactor-styles ol ol li {
  list-style-type: lower-alpha; }

.redactor-styles ol ol ol li {
  list-style-type: lower-roman; }

.redactor-styles p,
.redactor-styles ul,
.redactor-styles ol,
.redactor-styles dl,
.redactor-styles blockquote,
.redactor-styles hr,
.redactor-styles pre,
.redactor-styles table,
.redactor-styles figure,
.redactor-styles address {
  margin-bottom: 16px; }

.redactor-styles blockquote {
  position: relative;
  font-style: italic;
  color: rgba(0, 0, 0, 0.6); }

.redactor-styles blockquote cite {
  font-size: 80%; }

@media (min-width: 768px) {
  .redactor-styles blockquote {
    padding-left: 24px;
    border-left: 1px solid rgba(0, 0, 0, 0.1); } }

.redactor-styles address {
  font-style: normal; }

.redactor-styles dl dt {
  font-weight: bold; }

.redactor-styles dd {
  margin-left: 24px; }

.redactor-styles cite {
  color: rgba(0, 0, 0, 0.5);
  font-style: italic; }

.redactor-styles s,
.redactor-styles del {
  text-decoration: line-through; }

.redactor-styles abbr[title],
.redactor-styles dfn[title] {
  border-bottom: 1px dotted #000;
  cursor: help; }

.redactor-styles strong,
.redactor-styles b {
  font-weight: bold; }

.redactor-styles em,
.redactor-styles i {
  font-style: italic; }

.redactor-styles sub,
.redactor-styles sup {
  font-size: 10px;
  line-height: 0;
  position: relative;
  margin-left: .2rem; }

.redactor-styles sup {
  top: -.4rem; }

.redactor-styles sub {
  bottom: -.2rem; }

.redactor-styles strong:empty, .redactor-styles b:empty, .redactor-styles em:empty, .redactor-styles i:empty, .redactor-styles sup:empty, .redactor-styles sub:empty, .redactor-styles u:empty, .redactor-styles ins:empty {
  display: inline-block;
  min-width: 1em;
  min-height: 1rem; }

.redactor-styles figcaption {
  margin: 4px 0;
  font-size: 12px;
  font-style: italic;
  text-align: left; }

.redactor-styles ins,
.redactor-styles u {
  text-decoration: underline; }

.redactor-styles mark {
  background-color: #ffd61e;
  color: #000;
  text-decoration: none; }

.redactor-styles pre,
.redactor-styles code,
.redactor-styles kbd,
.redactor-styles samp,
.redactor-styles var,
.redactor-styles output {
  font-size: 90%;
  font-style: normal;
  font-family: Consolas, Menlo, Monaco, "Courier New", monospace; }

.redactor-styles pre {
  margin-top: 16px;
  font-size: 90%;
  line-height: 24px;
  color: rgba(0, 0, 0, 0.75);
  overflow: auto;
  background: rgba(0, 0, 0, 0.03);
  padding: 16px 20px;
  word-wrap: normal; }

.redactor-styles mark,
.redactor-styles code,
.redactor-styles samp,
.redactor-styles kbd {
  padding: 2px 4px 1px 4px;
  display: inline-block;
  line-height: 1;
  border-radius: 3px; }

.redactor-styles code {
  background: rgba(0, 0, 0, 0.05); }

.redactor-styles pre code {
  font-size: 100%;
  border: none;
  padding: 0;
  background: none;
  line-height: 24px; }

.redactor-styles var {
  color: rgba(0, 0, 0, 0.5); }

.redactor-styles samp {
  background: #46a9fc;
  color: rgba(255, 255, 255, 0.9); }

.redactor-styles kbd {
  background: #000;
  color: rgba(255, 255, 255, 0.85);
  white-space: nowrap; }

.redactor-styles hr {
  display: block;
  box-sizing: content-box;
  height: 1px;
  border: 0;
  border-top: 1px solid rgba(0, 0, 0, 0.1); }

.redactor-styles img,
.redactor-styles video,
.redactor-styles audio,
.redactor-styles embed,
.redactor-styles object {
  max-width: 100%; }

.redactor-styles img,
.redactor-styles video,
.redactor-styles embed,
.redactor-styles object {
  height: auto; }

.redactor-styles embed,
.redactor-styles object {
  height: 100%; }

.redactor-styles img {
  vertical-align: middle;
  -ms-interpolation-mode: bicubic; }

.redactor-styles table {
  border-collapse: collapse;
  max-width: 100%;
  width: 100%;
  empty-cells: show; }

.redactor-styles table caption {
  text-transform: uppercase;
  padding: 0;
  color: rgba(0, 0, 0, 0.5);
  font-size: 11px; }

.redactor-styles table th,
.redactor-styles table td {
  border: 1px solid #eee;
  padding: 16px;
  padding-bottom: 15px; }

.redactor-styles table tfoot th,
.redactor-styles table tfoot td {
  color: rgba(0, 0, 0, 0.5); }

.redactor-styles .video-container {
  height: 0;
  padding-bottom: 56.25%;
  position: relative;
  margin-bottom: 16px; }

.redactor-styles .video-container iframe,
.redactor-styles .video-container object,
.redactor-styles .video-container embed {
  position: absolute;
  top: 0;
  left: 0;
  width: 100% !important;
  height: 100% !important; }

/**
 * Angular JS slider directive
 *
 * (c) Rafal Zajac <rzajac@gmail.com>
 * http://github.com/rzajac/angularjs-slider
 *
 * Licensed under the MIT license
 */
/* Slider colors */
/* Slider size parameters */
rzslider {
  position: relative;
  display: inline-block;
  width: 100%;
  height: 4px;
  margin: 30px 0 15px 0;
  vertical-align: middle; }

rzslider span {
  position: absolute;
  display: inline-block;
  white-space: nowrap; }

rzslider span.rz-base {
  width: 100%;
  height: 100%;
  padding: 0; }

rzslider span.rz-bar-wrapper {
  width: 100%;
  height: 32px;
  padding-top: 16px;
  margin-top: -16px;
  box-sizing: border-box; }

rzslider span.rz-bar {
  z-index: 0;
  width: 100%;
  height: 4px;
  background: #EEE;
  -webkit-border-radius: 2px;
  -moz-border-radius: 2px;
  border-radius: 2px; }

rzslider span.rz-bar.rz-selection {
  z-index: 1;
  width: 0;
  background: #FFA200;
  -webkit-border-radius: 2px;
  -moz-border-radius: 2px;
  border-radius: 2px; }

rzslider span.rz-pointer {
  top: -14px;
  z-index: 2;
  width: 32px;
  height: 32px;
  cursor: pointer;
  background-color: #F6F6F6;
  border: 1px solid #CCC;
  -webkit-border-radius: 16px;
  -moz-border-radius: 16px;
  border-radius: 16px; }

rzslider span.rz-pointer:after {
  position: absolute;
  top: 12px;
  left: 12px;
  width: 8px;
  height: 8px;
  background: #ffffff;
  -webkit-border-radius: 4px;
  -moz-border-radius: 4px;
  border-radius: 4px;
  content: ''; }

rzslider span.rz-pointer:hover:after {
  background-color: #ffffff; }

rzslider span.rz-pointer.rz-active:after {
  background-color: #F6F6F6; }

rzslider span.rz-bubble {
  top: -36px;
  padding: 1px 3px;
  font-size: 90%;
  cursor: default; }

rzslider span.rz-bubble.rz-selection {
  top: 16px; }

rzslider span.rz-bubble.rz-limit {
  color: #55637d; }

/**
 * selectize.default.css (v0.12.1) - Default Theme
 * Copyright (c) 2013–2015 Brian Reavis & contributors
 *
 * Licensed under the Apache License, Version 2.0 (the "License"); you may not use this
 * file except in compliance with the License. You may obtain a copy of the License at:
 * http://www.apache.org/licenses/LICENSE-2.0
 *
 * Unless required by applicable law or agreed to in writing, software distributed under
 * the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF
 * ANY KIND, either express or implied. See the License for the specific language
 * governing permissions and limitations under the License.
 *
 * @author Brian Reavis <brian@thirdroute.com>
 */
.selectize-control.plugin-drag_drop.multi > .selectize-input > div.ui-sortable-placeholder {
  visibility: visible !important;
  background: #f2f2f2 !important;
  background: rgba(0, 0, 0, 0.06) !important;
  border: 0 none !important;
  -webkit-box-shadow: inset 0 0 12px 4px #ffffff;
  box-shadow: inset 0 0 12px 4px #ffffff; }

.selectize-control.plugin-drag_drop .ui-sortable-placeholder::after {
  content: '!';
  visibility: hidden; }

.selectize-control.plugin-drag_drop .ui-sortable-helper {
  -webkit-box-shadow: 0 2px 5px rgba(0, 0, 0, 0.2);
  box-shadow: 0 2px 5px rgba(0, 0, 0, 0.2); }

.selectize-dropdown-header {
  position: relative;
  padding: 5px 8px;
  border-bottom: 1px solid #d0d0d0;
  background: #f8f8f8;
  -webkit-border-radius: 3px 3px 0 0;
  -moz-border-radius: 3px 3px 0 0;
  border-radius: 3px 3px 0 0; }

.selectize-dropdown-header-close {
  position: absolute;
  right: 8px;
  top: 50%;
  color: #303030;
  opacity: 0.4;
  margin-top: -12px;
  line-height: 20px;
  font-size: 20px !important; }

.selectize-dropdown-header-close:hover {
  color: #000000; }

.selectize-dropdown.plugin-optgroup_columns .optgroup {
  border-right: 1px solid #f2f2f2;
  border-top: 0 none;
  float: left;
  -webkit-box-sizing: border-box;
  -moz-box-sizing: border-box;
  box-sizing: border-box; }

.selectize-dropdown.plugin-optgroup_columns .optgroup:last-child {
  border-right: 0 none; }

.selectize-dropdown.plugin-optgroup_columns .optgroup:before {
  display: none; }

.selectize-dropdown.plugin-optgroup_columns .optgroup-header {
  border-top: 0 none; }

.selectize-control.plugin-remove_button [data-value] {
  position: relative;
  padding-right: 24px !important; }

.selectize-control.plugin-remove_button [data-value] .remove {
  z-index: 1;
  /* fixes ie bug (see #392) */
  position: absolute;
  top: 0;
  right: 0;
  bottom: 0;
  width: 17px;
  text-align: center;
  font-weight: bold;
  font-size: 12px;
  color: inherit;
  text-decoration: none;
  vertical-align: middle;
  display: inline-block;
  padding: 2px 0 0 0;
  border-left: 1px solid #0073bb;
  -webkit-border-radius: 0 2px 2px 0;
  -moz-border-radius: 0 2px 2px 0;
  border-radius: 0 2px 2px 0;
  -webkit-box-sizing: border-box;
  -moz-box-sizing: border-box;
  box-sizing: border-box; }

.selectize-control.plugin-remove_button [data-value] .remove:hover {
  background: rgba(0, 0, 0, 0.05); }

.selectize-control.plugin-remove_button [data-value].active .remove {
  border-left-color: #00578d; }

.selectize-control.plugin-remove_button .disabled [data-value] .remove:hover {
  background: none; }

.selectize-control.plugin-remove_button .disabled [data-value] .remove {
  border-left-color: #aaaaaa; }

.selectize-control {
  position: relative; }

.selectize-dropdown,
.selectize-input,
.selectize-input input {
  color: #303030;
  font-family: inherit;
  font-size: 13px;
  line-height: 18px;
  -webkit-font-smoothing: inherit; }

.selectize-input,
.selectize-control.single .selectize-input.input-active {
  background: #ffffff;
  cursor: text;
  display: inline-block; }

.selectize-input {
  border: 1px solid #d0d0d0;
  padding: 8px 8px;
  display: inline-block;
  width: 100%;
  overflow: hidden;
  position: relative;
  z-index: 1;
  -webkit-box-sizing: border-box;
  -moz-box-sizing: border-box;
  box-sizing: border-box;
  -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.1);
  box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.1);
  -webkit-border-radius: 3px;
  -moz-border-radius: 3px;
  border-radius: 3px; }

.selectize-control.multi .selectize-input.has-items {
  padding: 5px 8px 2px; }

.selectize-input.full {
  background-color: #ffffff; }

.selectize-input.disabled,
.selectize-input.disabled * {
  cursor: default !important; }

.selectize-input.focus {
  -webkit-box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.15);
  box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.15); }

.selectize-input.dropdown-active {
  -webkit-border-radius: 3px 3px 0 0;
  -moz-border-radius: 3px 3px 0 0;
  border-radius: 3px 3px 0 0; }

.selectize-input > * {
  vertical-align: baseline;
  display: -moz-inline-stack;
  display: inline-block;
  zoom: 1;
  *display: inline; }

.selectize-control.multi .selectize-input > div {
  cursor: pointer;
  margin: 0 3px 3px 0;
  padding: 2px 6px;
  background: #1da7ee;
  color: #ffffff;
  border: 1px solid #0073bb; }

.selectize-control.multi .selectize-input > div.active {
  background: #92c836;
  color: #ffffff;
  border: 1px solid #00578d; }

.selectize-control.multi .selectize-input.disabled > div,
.selectize-control.multi .selectize-input.disabled > div.active {
  color: #ffffff;
  background: #d2d2d2;
  border: 1px solid #aaaaaa; }

.selectize-input > input {
  display: inline-block !important;
  padding: 0 !important;
  min-height: 0 !important;
  max-height: none !important;
  max-width: 100% !important;
  margin: 0 1px !important;
  text-indent: 0 !important;
  border: 0 none !important;
  background: none !important;
  line-height: inherit !important;
  -webkit-user-select: auto !important;
  -webkit-box-shadow: none !important;
  box-shadow: none !important; }

.selectize-input > input::-ms-clear {
  display: none; }

.selectize-input > input:focus {
  outline: none !important; }

.selectize-input::after {
  content: ' ';
  display: block;
  clear: left; }

.selectize-input.dropdown-active::before {
  content: ' ';
  display: block;
  position: absolute;
  background: #f0f0f0;
  height: 1px;
  bottom: 0;
  left: 0;
  right: 0; }

.selectize-dropdown {
  position: absolute;
  z-index: 10;
  border: 1px solid #d0d0d0;
  background: #ffffff;
  margin: -1px 0 0 0;
  border-top: 0 none;
  -webkit-box-sizing: border-box;
  -moz-box-sizing: border-box;
  box-sizing: border-box;
  -webkit-box-shadow: 0 1px 3px rgba(0, 0, 0, 0.1);
  box-shadow: 0 1px 3px rgba(0, 0, 0, 0.1);
  -webkit-border-radius: 0 0 3px 3px;
  -moz-border-radius: 0 0 3px 3px;
  border-radius: 0 0 3px 3px; }

.selectize-dropdown [data-selectable] {
  cursor: pointer;
  overflow: hidden; }

.selectize-dropdown [data-selectable] .highlight {
  background: rgba(125, 168, 208, 0.2);
  -webkit-border-radius: 1px;
  -moz-border-radius: 1px;
  border-radius: 1px; }

.selectize-dropdown [data-selectable],
.selectize-dropdown .optgroup-header {
  padding: 5px 8px; }

.selectize-dropdown .optgroup:first-child .optgroup-header {
  border-top: 0 none; }

.selectize-dropdown .optgroup-header {
  color: #303030;
  background: #ffffff;
  cursor: default; }

.selectize-dropdown .active {
  background-color: #f5fafd;
  color: #495c68; }

.selectize-dropdown .active.create {
  color: #495c68; }

.selectize-dropdown .create {
  color: rgba(48, 48, 48, 0.5); }

.selectize-dropdown-content {
  overflow-y: auto;
  overflow-x: hidden;
  max-height: 200px; }

.selectize-control.single .selectize-input,
.selectize-control.single .selectize-input input {
  cursor: pointer; }

.selectize-control.single .selectize-input.input-active,
.selectize-control.single .selectize-input.input-active input {
  cursor: text; }

.selectize-control.single .selectize-input:after {
  content: ' ';
  display: block;
  position: absolute;
  top: 50%;
  right: 15px;
  margin-top: -3px;
  width: 0;
  height: 0;
  border-style: solid;
  border-width: 5px 5px 0 5px;
  border-color: #808080 transparent transparent transparent; }

.selectize-control.single .selectize-input.dropdown-active:after {
  margin-top: -4px;
  border-width: 0 5px 5px 5px;
  border-color: transparent transparent #808080 transparent; }

.selectize-control.rtl.single .selectize-input:after {
  left: 15px;
  right: auto; }

.selectize-control.rtl .selectize-input > input {
  margin: 0 4px 0 -2px !important; }

.selectize-control .selectize-input.disabled {
  opacity: 0.5;
  background-color: #fafafa; }

.selectize-control.multi .selectize-input.has-items {
  padding-left: 5px;
  padding-right: 5px; }

.selectize-control.multi .selectize-input.disabled [data-value] {
  color: #999;
  text-shadow: none;
  background: none;
  -webkit-box-shadow: none;
  box-shadow: none; }

.selectize-control.multi .selectize-input.disabled [data-value],
.selectize-control.multi .selectize-input.disabled [data-value] .remove {
  border-color: #e6e6e6; }

.selectize-control.multi .selectize-input.disabled [data-value] .remove {
  background: none; }

.selectize-control.multi .selectize-input [data-value] {
  text-shadow: 0 1px 0 rgba(0, 51, 83, 0.3);
  -webkit-border-radius: 3px;
  -moz-border-radius: 3px;
  border-radius: 3px;
  background-color: #1b9dec;
  background-image: -moz-linear-gradient(top, #1da7ee, #178ee9);
  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#1da7ee), to(#178ee9));
  background-image: -webkit-linear-gradient(top, #1da7ee, #178ee9);
  background-image: -o-linear-gradient(top, #1da7ee, #178ee9);
  background-image: linear-gradient(to bottom, #1da7ee, #178ee9);
  background-repeat: repeat-x;
  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#ff1da7ee', endColorstr='#ff178ee9', GradientType=0);
  -webkit-box-shadow: 0 1px 0 rgba(0, 0, 0, 0.2), inset 0 1px rgba(255, 255, 255, 0.03);
  box-shadow: 0 1px 0 rgba(0, 0, 0, 0.2), inset 0 1px rgba(255, 255, 255, 0.03); }

.selectize-control.multi .selectize-input [data-value].active {
  background-color: #0085d4;
  background-image: -moz-linear-gradient(top, #008fd8, #0075cf);
  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#008fd8), to(#0075cf));
  background-image: -webkit-linear-gradient(top, #008fd8, #0075cf);
  background-image: -o-linear-gradient(top, #008fd8, #0075cf);
  background-image: linear-gradient(to bottom, #008fd8, #0075cf);
  background-repeat: repeat-x;
  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#ff008fd8', endColorstr='#ff0075cf', GradientType=0); }

.selectize-control.single .selectize-input {
  -webkit-box-shadow: 0 1px 0 rgba(0, 0, 0, 0.05), inset 0 1px 0 rgba(255, 255, 255, 0.8);
  box-shadow: 0 1px 0 rgba(0, 0, 0, 0.05), inset 0 1px 0 rgba(255, 255, 255, 0.8);
  background-color: #f9f9f9;
  background-image: -moz-linear-gradient(top, #fefefe, #f2f2f2);
  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#fefefe), to(#f2f2f2));
  background-image: -webkit-linear-gradient(top, #fefefe, #f2f2f2);
  background-image: -o-linear-gradient(top, #fefefe, #f2f2f2);
  background-image: linear-gradient(to bottom, #fefefe, #f2f2f2);
  background-repeat: repeat-x;
  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#fffefefe', endColorstr='#fff2f2f2', GradientType=0); }

.selectize-control.single .selectize-input,
.selectize-dropdown.single {
  border-color: #b8b8b8; }

.selectize-dropdown .optgroup-header {
  padding-top: 7px;
  font-weight: bold;
  font-size: 0.85em; }

.selectize-dropdown .optgroup {
  border-top: 1px solid #f0f0f0; }

.selectize-dropdown .optgroup:first-child {
  border-top: 0 none; }

.tipsy {
  font-size: 1.3rem;
  line-height: 1.3;
  position: absolute;
  padding: 5px;
  z-index: 100000; }

.tipsy-inner {
  background-color: #000;
  color: #FFF;
  max-width: 200px;
  padding: 8px 10px 7px 10px;
  text-align: left; }

/* Rounded corners */
.tipsy-inner {
  border-radius: 3px;
  -moz-border-radius: 3px;
  -webkit-border-radius: 3px; }

/* Uncomment for shadow */
/*.tipsy-inner { box-shadow: 0 0 5px #000000; -webkit-box-shadow: 0 0 5px #000000; -moz-box-shadow: 0 0 5px #000000; }*/
.tipsy-arrow {
  position: absolute;
  width: 0;
  height: 0;
  line-height: 0;
  border: 5px dashed #000; }

/* Rules to colour arrows */
.tipsy-arrow-n {
  border-bottom-color: #000; }

.tipsy-arrow-s {
  border-top-color: #000; }

.tipsy-arrow-e {
  border-left-color: #000; }

.tipsy-arrow-w {
  border-right-color: #000; }

.tipsy-n .tipsy-arrow {
  top: 0px;
  left: 50%;
  margin-left: -5px;
  border-bottom-style: solid;
  border-top: none;
  border-left-color: transparent;
  border-right-color: transparent; }

.tipsy-nw .tipsy-arrow {
  top: 0;
  left: 10px;
  border-bottom-style: solid;
  border-top: none;
  border-left-color: transparent;
  border-right-color: transparent; }

.tipsy-ne .tipsy-arrow {
  top: 0;
  right: 10px;
  border-bottom-style: solid;
  border-top: none;
  border-left-color: transparent;
  border-right-color: transparent; }

.tipsy-s .tipsy-arrow {
  bottom: 0;
  left: 50%;
  margin-left: -5px;
  border-top-style: solid;
  border-bottom: none;
  border-left-color: transparent;
  border-right-color: transparent; }

.tipsy-sw .tipsy-arrow {
  bottom: 0;
  left: 10px;
  border-top-style: solid;
  border-bottom: none;
  border-left-color: transparent;
  border-right-color: transparent; }

.tipsy-se .tipsy-arrow {
  bottom: 0;
  right: 10px;
  border-top-style: solid;
  border-bottom: none;
  border-left-color: transparent;
  border-right-color: transparent; }

.tipsy-e .tipsy-arrow {
  right: 0;
  top: 50%;
  margin-top: -5px;
  border-left-style: solid;
  border-right: none;
  border-top-color: transparent;
  border-bottom-color: transparent; }

.tipsy-w .tipsy-arrow {
  left: 0;
  top: 50%;
  margin-top: -5px;
  border-right-style: solid;
  border-left: none;
  border-top-color: transparent;
  border-bottom-color: transparent; }

/**
 * vAccordion - AngularJS multi-level accordion component
 * @version v1.5.2
 * @link http://lukaszwatroba.github.io/v-accordion
 * @author Łukasz Wątroba <l@lukaszwatroba.com>
 * @license MIT License, http://www.opensource.org/licenses/MIT
 */
/***************************************
  vAccordion
 ***************************************/
/**
 * Example HTML:
 *
  <v-accordion class="vAccordion--default">
    <v-pane>
      <v-pane-header id="pane-header" aria-controls="pane-content">
         [content]
      </v-pane-header>
      <v-pane-content id="pane-content" aria-labelledby="pane-header">
        [content]
      </v-pane-content>
    </v-pane>
  </v-accordion>
 */
/* Base styles
 ***************************************/
v-accordion {
  display: block; }

v-pane {
  display: block; }

v-pane.is-expanded > v-pane-content > div {
  display: visible; }

v-pane[disabled] > v-pane-header {
  opacity: 0.6;
  pointer-events: none; }

v-pane-header {
  display: block;
  position: relative;
  cursor: pointer;
  -webkit-user-select: none;
  -moz-user-select: none;
  -ms-user-select: none;
  user-select: none;
  outline: none; }

v-pane-header:focus {
  outline: none; }

v-pane-header > div {
  display: block; }

v-pane-content {
  display: block;
  position: relative;
  overflow: hidden;
  max-height: 0px; }

v-pane-content > div {
  visibility: none; }

/*
	Do not make any manual changes to this file. Take the ss-icons-embedded.css out of the
	fontello export, remove the first @font-face declaration, and paste the resulting css
	below this comment.

	ALWAYS start a fontello session by importing the config/fontello.json file, make your
	needed icon changes, then export the resulting font. Always copy the config.json from
	the export into /config/fontello.json.
*/
@font-face {
  font-family: 'ss-icons';
  src: url("data:application/octet-stream;base64,d09GRgABAAAAAG1QAA8AAAAAxNgAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAABHU1VCAAABWAAAADsAAABUIIslek9TLzIAAAGUAAAAQwAAAFZWVlMrY21hcAAAAdgAAAPQAAAJWsDbCKpjdnQgAAAFqAAAABoAAAAoDN7+MWZwZ20AAAXEAAAFkAAAC3CKkZBZZ2FzcAAAC1QAAAAIAAAACAAAABBnbHlmAAALXAAAWaYAAKBu+HffMmhlYWQAAGUEAAAANAAAADYTNtbRaGhlYQAAZTgAAAAgAAAAJAmSBjVobXR4AABlWAAAAMYAAAI0/IT/pWxvY2EAAGYgAAABHAAAARyxSttpbWF4cAAAZzwAAAAgAAAAIAJWDMpuYW1lAABnXAAAAYIAAALN5lrL+nBvc3QAAGjgAAAD8wAABp+AO3GocHJlcAAAbNQAAAB6AAAAhudDLb54nGNgZGBg4GIwYLBjYHJx8wlh4MtJLMljkGJgYYAAkDwymzEnMz2RgQPGA8qxgGkOIGaDiAIAJjsFSAB4nGNgZJ7NOIGBlYGBqYppDwMDQw+EZnzAYMjIBBRlYGVmwAoC0lxTGBwYjD7+YA76n8UQxRzNMAsozAiSAwD1NAwgAHicxdY3d1R3GMThn4QQEso5kHOOIgeDiCInkXPGOYJzTtimdu2PQOHKLRXfZErtoaHD82du4cJ24ca759HR7urcvXt33ncETAYm2XJrgPo/qPNv1P3uZ+tePj+JqS+fb6h76MeDdPqZJkbYzLjuTfw68XjiWe1B7Untae35ixf+i7WsZ1RUr9z/yyt/d6vzEYeZy1jdYHUfLveXr9T7nRp8ho1M8Ts2+zxaaKWNdjp8Fl1000MvffQz4KMM+TjTmM4MZjKL2czxUecxnwUsZBGLWcJSlvnzrGAlq1jNGp/pCOt8thvYyCZ/ni1sZRvbeYUd7GSUXexmD3vZx37GOMBBDnGYIxzlGMc5wUlOMc5pznCWc5znAhe5xGWucJVrXOcGN7nFbe5wl3u8ymu8zhu8yVu8zTu8y3u8zwfc5wEf8hEf8wmf8hmf8wVf8hVf8w3f8h3f8wM/8pCf+JlfeOQL0/gP1/Jfb3W+mg2TG6dUD5uap7a0trV3dHZ19/T29Q8MDg1P+y+H/b9ureVH42/VI18Vf5tRUjtSqbf1lZLyDRUn3d95lAnYVClXdnOlXKnRSpPtqjTb7oonwwmJFttbKWe3r9Jm+yvtNlbpsAOVTjtY6bJDlW47XOmxI5VeO1rps2OVfjteGbATlUE7WRmyU5UyZ+MVf/0iPEWoLjxPqD48WWhSeMZQQ3ja0OTw3KHG8ASiKeFZRE3hqUTN4flEU8OTilrCM4taw9OL2sJzjNrDE406wrONOqNsM3WF5x11hycf9YR3AOoNbwPUF94LqD9KnjQQJU8aDG8NNBQlWxqOki1Ni5ItTY+SLc2Iki3NDG8cNCu8e9Ds8BZCc8L7CM0NbyY0L7yj0PzwtkILouRVC6PkVYui5FWLo+RVS6LkVUuj5FXLouRVy6PkVSui5FUro+RVq6LkVauj5FVrouRVa6PkVSNR8qp1UfKq9VHyqg1R8qqNUfKqTVHyqs3h/Yu2hDcx2hreyWhbeDuj7eE9jV4Jb2y0I7y70c7wFkej4X2OdoU3O9od3vFoT3jbo73hvY/2hRsA7Q93ARoLtwI6EO4HdDDcFOhQuDPQ4XB7oCPhHkFHw42CjoW7BR0Ptww6Ee4bdDLcPOhUuIPQeLiN0OlwL6Ez4YZCZ8Ndhc6FWwudD/cXuhBuMnQx3GnoUrjd0OVwz6Er4cZDV8Pdh66FWxBdD/chuhFuRnQz3JHoVrgt0e1wb6I74QZFd8Ndiu6FW9X/n4T7lYnH4aZl4lm4c6ndD7cvtQfhHqb2JNzI1J6Gu5na8+DRnwXeha94nGNgwA6YOf8fZY7+n8Ys838BiAYAN+IHFQAAeJytVml300YUHXlJnIQsJQstamHExGmwRiZswYAJQbJjIF2crZWgixQ76b7xid/gX/Nk2nPoN35a7xsvJJC053Cak6N3583VzNtlElqS2AvrkZSbL8XU1iaN7DwJ6YZNy1F8KDt7IWWKyd8FURCtltq3HYdERCJQta6wRBD7HlmaZHzoUUbLtqRXTcotPekuW+NBvVXffho6yrE7oaRmM3RoPbIlVRhVokimPVLSpmWo+itJK7y/wsxXzVDCiE4iabwZxtBI3htntMpoNbbjKIpsstwoUiSa4UEUeZTVEufkigkMygfNkPLKpxHlw/yIrNijnFawS7bT/L4vead3OT+xX29RtuRAH8iO7ODsdCVfhFtbYdy0k+0oVBF213dCbNnsVP9mj/KaRgO3KzK90IxgqXyFECs/ocz+IVktnE/5kkejWrKRE0HrZU7sSz6B1uOIKXHNGFnQ3dEJEdT9kjMM9pg+Hvzx3imWCxMCeBzLekclnAgTKWFzNEnaMHJgJWWLKqn1rpg45XVaxFvCfu3a0ZfOaONQd2I8Ww8dWzlRyfFoUqeZTJ3aSc2jKQ2ilHQmeMyvAyg/oklebWM1iZVH0zhmxoREIgIt3EtTQSw7saQpBM2jGb25G6a5di1apMkD9dyj9/TmVri501PaDvSzRn9Wp2I62AvT6WnkL/Fp2uUiRen66Rl+TOJB1gIykS02w5SDB2/9DtLL15YchdcG2O7t8yuofdZE8KQB+xvQHk/VKQlMhZhViFZAYq1rWZbJ1awWqcjUd0OaVr6s0wSKchwXx76Mcf1fMzOWmBK+34nTsyMuPXPtSwjTHHybdT2a16nFcgFxZnlOp1mW7+s0x/IDneZZntfpCEtbp6MsP9RpgeVHOh1jeUELmnTfwZCLMOQCDpAwhKUDQ1hegiEsFQxhuQhDWBZhCMslGMLyYxjCchmGsLysZdXUU0nj2plYBmxCYGKOHrnMReVqKrlUQrtoVGpDnhJulVQUz6p/ZaBePPKGObAWSJfIml8xzpWPRuX41hUtbxo7V8Cx6m8fjvY58VLWi4U/Bf/V1lQlvWLNw5Or8BuGnmwnqjapeHRNl89VPbr+X1RUWAv0G0iFWCjKsmxwZyKEjzqdhmqglUPMbMw8tOt1y5qfw/03MUIWUP34NxQaC9yDTllJWe3grNXX27LcO4NyOBMsSTE38/pW+CIjs9J+kVnKno98HnAFjEpl2GoDrRW82ScxD5neJM8EcVtRNkja2M4EiQ0c84B5850EJmHqqg3kTuGGDfgFYW7BeSdconqjLIfuRezzKKT8W6fiRPaoaIzAs9kbYa/vQspvcQwkNPmlfgxUFaGpGDUV0DRSbqgGX8bZum1Cxg70Iyp2w7Ks4sPHFveVkm0ZhHykiNWjo5/WXqJOqtx+ZhSX752+BcEgNTF/e990cZDKu1rJMkdtA1O3GpVT15pD41WH6uZR9b3j7BM5a5puuiceel/TqtvBxVwssPZtDtJSJhfU9WGFDaLLxaVQ6mU0Se+4BxgWGNDvUIqN/6v62HyeK1WF0XEk307Ut9HnYAz8D9h/R/UD0Pdj6HINLs/3mhOfbvThbJmuohfrp+g3MGutuVm6BtzQdAPiIUetjrjKDXynBnF6pLkc6SHgY90V4gHAJoDF4BPdtYzmUwCj+Yw5PsDnzGHQZA6DLeYw2GbOGsAOcxjsMofBHnMYfMGcdYAvmcMgZA6DiDkMnjAnAHjKHAZfMYfB18xh8A1z7gN8yxwGMXMYJMxhsK/p1jDMLV7QXaC2QVWgA1NPWNzD4lBTZcj+jheG/b1BzP7BIKb+qOn2kPoTLwz1Z4OY+otBTP1V050h9TdeGOrvBjH1D4OY+ky/GMtlBr+MfJcKB5RdbD7n74n3D9vFQLkAAQAB//8AD3ic3L0JfFxHlTday93v7dvbXdStVkvdre7WvnSru2XZltuWbMu2LC9RHMmxFSVeEltxFrKSxA4kGYY9kAkBkrCYgSQkISTOBgzbQGBCYHhhC8zAN8ywfDgMhOWFGQhS+52q263NNoE3M9/v/Z6tvn2rblXdWk6d8z+nTlUjH0KnbqB/Q9chP2pEvWgt2oEuRFei16N3ouPoMfT36Bt4xZZHI9snyjegMPLR8AHkk6lvH5IplfchTQgI2gEUcITAPuREBGdfFNchjOrwNEKIEkSnUQjZ/pA9jQzkVw3/NJKQKkrqNCJIVIg4jSzkBi13GpkoqJvBaaQgXVD0aSQIkQkUifgjm+rLN/8ff7kWEcarVRAio5Pl3DNf+NpXvvCNZ77xuU8//cTHH77/wx+499133v7Wv77t5puuu/rySy/ef8Ge88a3jRbgXwk+uXqxoR1bUiqRzKzGfcV8IufYQUtqx154Jc45DXRp2M4ue47/dNim/8PpcSIpQaUdqHyxEOzL0HbLnHvBtCyTtLFr6rTLx84U+d/1mLTNjcZaW2PkiYaWFqKbtm1+jF0q97ErT/W5II95nt2/eT72+TPc4dJ/5TGtb2mY/QKrDB1saEFIgHl0mJ6k5/B51I2G0WB5ZUtTXUBAGG9EVMCYHmBEh8gBiBEmgbTMEaBScQKJol/cVF5TLHS0NScbonZIEq32tCP5sZTJ0kxxDS46bnXoYBSWDOV8GPdlM9lMkyzJUsB1XKepVCwVaQtRlfWKn1xT/f5rQ92gGvzyXkO9QvHxCzl3eOjKqyu/vvrKoWF2hwPs7gik90M++PNu5n6i+HwKcdh17ucL95WX3ljLuVAGNI3M94mFDqPzyuP5HBEp9IaMKMzgI0ikEhWlI0gSqCTMIIFQgcwgginBM4hSNKFghKCXMPbjTRjt37d1dOOG1au6O5sadA1Z2FKho3ByaZsDrB/CGOL8OCWlepOZbC/EFPqKJVws5XNu3pUdGZvYceM4B52Li33dOJP0s6gc9LVbch3LzwrIQHzfGjwI/duI41jCL79xaRexuw9UvhTS4y2iYsjpofpmnxiL4kZRI6qIA4qkVf4tGgpGrd5iT1jGhfoojmyPnjJxY7v5Y8XEPln+sS8UWekoDQ2nrMKKgkWioTDdeabxqGyufCkgWwomsWhzwbXSw+xFRNCJn71lw4Zo2AqHJVysH63H9fUVf3sDvIPIPtmGlyiGEpbjO+OnLMexaGwT0B6F8fk4fYb6kIMyaBBly82aTCgMwMZVXa0Ur0eY4MthGMnlMJoHO9rrIxYV7fZ0b1aUktm0LNmW49qikyvZ6WIf7hXdEnxn05mkLEqWWEvWa2LbclmydLEATORT91d+p1la5Xf3a5KAPyewizZ7GH9OluFGq6yFmMpajd4F6ZQ6BdIJkoY/RzQCj8W7Nl8ritduFjXg3/jLhOB/EG38rn/A7FuE8JdF+7NbrhOE67ZgFRLxB5qoQguAmE49Qq+hQZREry0bUZUIKGIQSsjGLY/aIOHqYBpTLIDUIARNQA6D0Z4Pb6rf8mgLf44pvuK0RATkU0P1EZDwOCN96EUmwOgETH06Ojn5dMRO2pYoRtoxEKPMqTOYDwK9MsJldLsGB1m0LGUz+OX+1X2F9rZ4vR1fv/mK/avWQKilIRoORxta2gt9a8iPYpoqUkPVtdn/C19ZL0q5uKEK1FAMDX9dgy8qaAZC3hjX5mADWoFWlVesyDRRQWRMCYkCFad4OyRvpgkCnqhNt57uxnh91HW8qSafbarRYs6xpGSmL5wqsLkCwiPbhWHmpAol17biuBE7+TPOnBOBjqamjqa/ecjUgRAEn0p14a8E1ScJEj3LFPhJINmWTLZVdjqYirrxcUVTVIqpowi/0vwyxmShzdfTnage6DqHtKc7sqlGE9HO9nTJXUOzpWypm8pZP3VlV26kMLnXYJf6SVqSS40YWiZ3Y/zRLVv6t9WvU1pblXX12/qXhG7PDgW2u+++Prh3uHJ3bsO73e2BoezY0NQXotF+dUvbtqHhsfbNWikSKWmb28eGh7ZBaOrCB1reoLbhzk5j3Y3HPt6mvqHlgQuj6wyPLq+jP6DrkYukxx0Nd7aLYbmULmXFrBt2S7Qki7KbdrM0i1c3//pvK394+QUsHXk+uu/u9G8+hOXfvVB5hYVmqpHNv/4Qll5+ofLHS6tJKq/8bjktxFAKnV+eSGCQTBsB9MhIkY8gWRQBVhFRALZyBAFxCBQYsSTRfSCk0KTqEYkk4ckakaSSTY3xhlh9NFLnOrZHKtpZSSVlpwqpQj6conm3dGaieGr7yu3ff3Hz4aHR0aGzEMGBH/6wr/JLHP72txfLXQs1oQ7Uj7aWNyNRw4IkChfqWEIykeRpFSgDpiRMWozNESZW/GhTd2cq4doYFXKd/d39rZlER6oDxG+T2+S1w4B2iLn52i/IVgaLPFDUl0nza4rHiIviFzVuUQNuqMScxkYH/wSuFYl/OTwKv7LoyV1Lu8TLj69t7IjHOxpnGzsa4W+T94WqfO1x+nmqIhU1lKMEo/WqIkuiiIfZw8uhzQdDASI67Tih44RI0yKln68cP3KkchzHLsYudg/iv8cjlU88V/n0Zz7DcvEyv0Q/S36PEqjwhAUSeXjLozHggQYU7/FFA/hiGXhy7RWTZR0DBaEETlBOAZLchVNJzvyd6v9iqfq/0NeFyScHDqbTBwY2vnbDqu7dhYPtoYZAoCHUfrCwu3vVhuvJf3a3tXVveO3Giy8cG+vc1OhzAgHH17ipc2zswoshz5Kxb0DtqIBWlwdyve1tAsERABGODYNONzJAgQnADUo5czNHBG/8MWqor3O9sRbPNtYwEfMg5lbibK8f8xtIhGFmMsTglkDsnWmgI49k18tC6T20QxbIswD++h7C0j1Uo1se2kLPPLxa9pGSIJ8rPksEuYOwHOV7KE+vLZu7h9FVaEN5qL87GYGJegkWxAsntg4JIGg2IlHCbNoy4VRtLAdSiDf40pkrLp+56tKrxne0ZiO2zAjCYg1tYk0OsMY3sSbLvRAuFRn6kQsyfHVhNpoMEmUzEsNJjZiFQF0A3u7KEkdHJbsE39A/DEMBhCoyYdCNi1WZkBFBRHBRQU+eaVY/skv2QbNpXlLG6twIloQRQcIRx91GFVqAAWzXpfMU5TxJb4dUBYjc5tgRqm5WaSQcHYNwHhJ16OouQRAqT7X092/v78dTZ+AwkxG3jqeXRNzhk1l6YZc8X+x2u1asbW9n7yaAgtp1eZei7JJ8LFUeYsdCDdU6vp29aHt/Fe9+kD5OYyiIIuiYhyniwKMoIAZGfsKEiAUhMMIGh3HQ4DyyqJ9PRRjo2ruQmMIkS9SeQgyotQIFmQ2ybme1HIK3Tk6WfaFQKAL/7UhAEuuqDJjPPE7WhUQ4mOA6Av7KZVPnF0ul4vlTP5g6v1CqHNmF7ywV9kyRZ6tx3sPL8MnKpTzpIvrbiQKgiTuor6w5djgUEGH6A3rKQRt0tADW61nI4wsQmnzCTXL2A4xSxlApMezkc8WSSsMgvE9qijy7StfxLe+XNADO+J7ZSTpS8X/krfi3tKxouHJAdKT3V47pkkifqRzBBytm5R14F/4tvFA4NXvqIP0F3QW1yqKVaBvwf03BgF5gyjNc1wY1s6EafA7w2UAmoN/8DLSFGaOjCE8vigUutn54cHVDzLEF4AnhLjxI4hhUBZgXoI6x/hvEcWJiGf4Aq3FuBuRvki4MuCebKRU5q4NZ0kUGcQn+AOJxYJeolzvPObC3X6CtXdH6uuuGN61YS25t2b9nhdI1nt9xzUDCMEKR+kwbzi+k7ISU17KUc0e9lOfmFqUkna37ePbczmsGmnx6MBJLL8pO2uZfVMs+nt95zYpa9so/Qsrx/UtT8rE+RT9CPoN0QCQptK68BlEZA92RaQUoUESCOA2AETp1nOFGxmgQHo3WmQZBTQ11qWjKChqu6Soi0onOlLT0Ysl4FolJJ+b6mzo7m8izcJ2r419NPIqcXPTkA93ruuEPH/O+L/e+qnIQCPUk+QCgm/VPgsjHjDRVIAAHscrug6lC8DjckkmYQGRrPVCGR6VL4yef7E+lqei2Yy6nUiDJMuzCRFkcQ20HMUTTYTp01fCO10WT7fnNypodhd0FcmXvzp72Ufz6UHj4NUN7N0fW9QYPDRV39/XsnNrWW8NgH6d/CzqXAjwihUbKoabGSJ2ACAgJRDbCh0laxhNCiFUG4SNQscuAOLmeYVbVsZrMfaohlgpRmFvpBTkFtNZLoVeZVrZUVO3+TWFalbZ+C7pmUJUptgHvP/RLPPNd0RAv+eUlolL4zVZJvRZmTuWkrGKgdIof/uXkd0X+1KjigufpcfIL4AH9T/oZEVSVpwCr7eWMEpi26ENeZRdFHZx80nIt1q0qBpUwyWwboJXnGkEDzzm2JdN3Vhy9KZ3Qvmt2lp278KfdtZ0BcuXcUTMQ9ON8ONLUAbE/iXQ2Ru3luCdWjsiAe4BEsbAY9tiM76TDaTGcTtTjBPnIwcqLlRcvrvwEX3DkCL7gPz3A8xwDP5x//4x+n3wHxqYbDZXL3VgE7gaNAOJn6BhhGQEeRhKm0jR7PXC/aVCiBHEc8LEwAfNCGLXtVKsbCocUMQbi1QHK7sKSmAJKYsxjgSvn+SxIduG+QZyLA2XJKRd/NJ1Pwx/JHcP53Lnnfe28c3N5dnMwmk5Hh68aGrrqjVcNkRs/jaci6ea+ZpxeodkHa4l46nRfM08EpKlbn+Zt+jb9GjkJetBBVHxqxCIex7arHJujBKbiwgDyGY3mJ/Tkk2vLMQIKf80WwvmbJFf/93hIzkN2IPkZJHBAzS+WwsUMQIBBzB8xzjkP+3pqKi77DyUy21Ymm4ZCqeTQR9NpNSTIqtB8WXno9YOlrrZoa4DQZK5n/Za15XxHCCYJEeW1Jg5gJRATtwi+2RsD/kRYk0VDab5szdkyYUFeZ5JA5feBenFUMMl2yxZlSdPFzs1hW6qz04nMinWSOJBtASHq72rpFjVBDAjNSkjYIvj98DK9YqlqGFRsKaSclikYDvs7eSbJzzONCgE/vAz6V+Tz5XswX3SQnDHUinrQ8Se7sKzUBqEP1BKREvEIUkVFUQ8grGEkMMISdMyEPVAYKGeiMoVkWZoE7csnwWit+AuySZK8s5pZlrZOlhtDQabed3a0t2WbGxvqnGAsFAv4AbvrWGdaT3gRi8ZBuFuu5cwbhdOeKvcZcpmi6fLcHbKu06Rlzv49eUXWNHlOgivdMHsTt5neZlqV7Ze8dmrbtinyFd3UNFOfayOjppWCOwinLHPuCb9l+Y/htSdPIokzzAfJU9B3DOG3Ag0PomvKr4HRhymvqDAHDcYw0bSfKXoUFD0fU/QEUPRMLGiiMB7EGtJFTWdhgdlaBXG0kG9va4o7tg/E1cr+/GBhsLurLdeey6TirU2t0Yjd4DQEA4blszwBFmLazKIOkNmFS6zazWKFEJ8x8mL8cqKrK1Exmrq6PgWfcldXk/dFHuGRTTzBXPAMkSTSDVHl7iPsSbmr8p9eEKteGGsQgKi5X3rxnC/eSc+nWRRFh59ETIZUaS2KGFpEBGAmU4lmYMIHGCQK0hoQjSxPQellLBXmcMnj5AR4K4iIy+HZwcnJp+yMlRQY4mT9E4bGJmVs85ZT9pUr4SI9X5UrJ96LVVOsOIIq4zG490n45wJ+FOTMDmyo4tx/YOpXK4+CYqlJRBeqmFP4MmBOz6beWs4wJR6ofrrGuADQeYxX8Aub2NJLISeJ0fYqda7G3pDZrxrWhbcbgYDxx9fowbPdk3ewu/vYZe47Z7qt1jfF65tAK1CmnApC56+PRlTFE0pL2GtPZ0uaMNKSgU0yPcz1tE+Rhe1aBBMbadHkGhgoXEy/4kyWL8dcOj7a2tbasvmcXV09vd2n0LmleDxWnz9nMJFqTlVOVWaVmP6UHgjon9LqAQ8pukF3ls+/7KrfXnHk/HWHjt6CnVuPueXy2I7zzhnbXF639fwLDh66cOqaX8m6X38ePvKvFFEnv9MkTlMe/k8xOzEbB8TGAfgbCMlpbzWDg/1UPp3Kp9gogEyTUolgbaFifiGstmQRTOQcetLyVR4M+z7psyoPGOGQD09YEAjjXWYYf/qTPrvykM+2ffhcG2JDeAK0HF/lgdC87r8T6KIfjQC6f+ypTh+RSY3UV0EFZY3ITE4LgFqBAWiaPoGAz4wYuLru4hvxYUliRlrqG0HARieQqvpVoPX+5dl5HopE4DASoqpEFxe4KOtkObt5U28PRuds3zSxeWLD0ODKQl9Pf29/WzbZGHVDflVG3bjbzwY+xYe0tkSYYUPMSHMlX5YYZECTa9YszIZ7XoMGhZyRLZO3jIyzjDllqRfJBem3jio+Q5l7m6Kbyk1svedu1U8CxK8SUr25G2JnrwvW1SUjEXIDRFSm4UkTAd3pZVUlcz8jccXA27CpVN6k+sgY1kmXoRxlZR1VDCj7k6rPUMfZ7bhq+FSyUTGORaCwZKQyylIdY49I0VDx1SxYeatq1DDbYWkExo0gX5lZNky0KYgBZIg4QZtnfyCN3EVPenLTG18/6kMl0OsuRt8q+0tYUZu5ZpfHIt7goftNIAoEmGJHELNb7oNhUkXGuYhKyQySiEakAyAvNEPVpkGUGCDjpkEcogmfZ8+sauNcbd28qCxVEGf+C4VNlhMEXXThzh2bNw2sKBY62pmttD5qhYIBTUZ+4je5XFm2wpoq5HMAnQAfpWTJBVqwU4USKBxrcDgfdpk1Pe+m82yNxc806TjQDwBKgF8sV1+mdJZ4YlXKqd7eFP58Kpfr+YCsywCl5NCt9aKo1MtvE4gF2vVb294oSkFoIa68PNWBPyX4xbgoNqVSTSLc+IX2rq5RL65/9aoVLM4UhzZupDvzzbNfbs7nm+lAc35uTUYTA0qwb7Oh+jLNRDc0FV9ZuUMzQNmXT9x6oSQ2yoaY3nvRnjR8N4pS92tf99qHvNjBex+4ZxBKbRTFTU8/+4maffcxoAMDhVAS5XG4nLawIvdiEN8bbSzHsN6AtRzT+H3d2OzCfnkDwYFhjw3sRQIBohDZYiNhA4mCOMh1KiOIjRkU8AeuYIgeps0FzAiuy8pUCOtIU3VtCqlhSKwGp+DlPtPwsaUSGGLT9O9Cfr/PD/Ry/n9v+SbyB0w/fw8zRWRSqXAYuGmeQbXWFpAEzeFkOJloaowHg1YwGM6HApbY0J7OqzhfY6tivpCy8+FSIQtfdla2XYgoyHCf8j7wBP7wu56o/KDy/Sei4b8OR/E1/ZeXLu/vPvnDjxb6/+Vf+v/lvvvg2t/f+ZbKD0FruicUjYZ+/i+lyo39JYjF/f2lUv/9cMv/nM4ORE9VTl3C56sPBZGL3DIoOcGAX4GpMezN8hCb5Zgpo9RdQ0AbdXEWOFgpnaU/vFmNKE6b/VH4qLMff5A4D86NU0XB6EHy3M2qarc5H4WPEpn7OXs2+7Si0H0PojPaf0aeZKYf/P/S9DP0P2f6Gd8/1U/PbPq5euXptpszmn52Xn2a6efc3jObfviLrl1q+llkOaqafpZWCQFHQ6cOip30fNQMfHcY8Mp+dDX6K3QXuh99Aj2L7iy/MymQ0HoUoqHL2drm5UDKlqpZRwCiqxaox0EUwMEAIAIAkgL0rx8Zot/gDjcSc7jRkSnrJnPEkRUA7EAvYdUXZo43qsYgPbdUf/ELf/epJ5/42MMf/tt77/mbO97y5ltef8NrL7/s4oMXTJ23a9vYxg1rBkvF7q5sxgFFDpgoaNgy+3BWCv3uMMaZ826AnXLOios5GEoTcx28C/TTZeHwsrD7KuHs8qLk5RF0ecRpWZbXSUzu/9GP9sNnnx7SL/je9y6QKFHoBf/EbiRBk+aevfK3V+qabOuX/Osh3QZl678YvlOw9ENwayneI104PcLWIEKzzxpRcfiXMp+RKr2Jxp6exkSv6Jt9o+YTuxsbuwnhVypr9HpJq8xlMtR2NCGZFDTHfmc6LViOLqRSgu5YlRchaNs6ewjBNy95CCEKz2gqRXXbntVrqQSW6r16LRkP4oBeewNl77t16eO5f1tS1v/v1ke/9S3gcaf+CEzyW3Q3tEd6HJSAznbPUyjbRSSZOSIwRxj+vxT3WBZchG9hcSDb3/Guvzux9qrDu1d3tupNkbZ1e6597+A7Ng5c3HLRyqYkfswnTq7tiG2ctPpW1DfFVne85sb+jvSKusZYR1qVi23BwdR50G+sTw9xuVBboR1G29Ft5deLmBILw2UjIgLo7AdqcnE6iEG7l1VlOoBlJImyBPq9yAStMI0Mowa1TFxd0IOO3rh+5QpvOZegrZvXb9+4fe3giuGVw6cv7Qb9ioR8xBeeB19uFXrhbJ65wKUTDGYz7G1J2b/wng7O/jIU+TE5PxSJzH3omx8J1+MfVe5nyiGeZGrY3KeNQFAnw2e6DxinxdOdkdBc5seREL0jFJnt+lZ9+CMfC7BV0MC7al9uAP7eFWSh4F1eJMdMl9L/TXcAJw0hB0VRuewDAgSlMhRUFhZs+FLuwooND9Y6FGQhQR5MpafB1C6MS24pi+FTcukNs7/pHBzspP6uQbx6LlzektiMz9uc3LJlM92xunP21/xhoHP17Hdu25Jkj5o3b9nCZfc8xg+jdrQWnYf+ecujIahYCUmCKADOZsiKeYTJApFnQF4wp0+FUmVfzVHFW97kEw+kRv2WR9sh+wovO8Nky/ILsjLzJwsoD7xaXkGBKX/GzJOT5QhBO7avHOjqbMs2p+INUddQUZiE2YQXE8kuDGTG1bo4hs40sbeenAOQPsgeAXTFTFeW0hnPO02WPKc0mJEFBu29WJsh+ziuxtKjsy819DbAHw3x79mXA/puXX5Isf1+W3lIhkAAf111A0Rty6pai6STYJ2cacuVeVxHb2tGwYE6uat35V0LpTTwUknvB/WAfLeC/Tr+je7Hyt2y/1IZQ/704f6VOVGuD6qZ/cWBS7cprNDszMrivoxSF1C7rlu78fULY/wi1+OK6F3oX3Gh3N5YBxO+OwDA+avPkHDoX79IguEnPgwK0RtvvoYa+qoBomr7xokiK1UUtx94LXMOPMKtP6CVhUPBUBjoA1kh0WJOvkEzFJyeh88B5NMDPoY1OD8BeC0rBmANYCuSqkzxJXF7nllP1GbAgTO+Jnjkv/c9k+Vegr7/vee//uw//N0nH33kgfvvvfv2t912y43XH5m5+ODEedvHNg7ne9uzqYQV8iagc6YJyMF+oVToW+rA61qLHXkLYebICPQFER5tdeMCS11NBMpkT2+hJ1/q6WXGsG6cYrxsJe7HvaW8F5NpZyHZtqq5+9bgPHtXI3HsgldoDzyW541TC07EzKcNkvb0lor5QrX8nlpRrBb8cY5XD8j4V51rBrtosHMNHpz7N5FuxJisoKJIz1M0jDewVfrPUfHHog9jnyjWifK9phgVfDYVFeUNWCPEd7Wiacq1kBjD5w1+kdYBfBLrsSi/T5EEh2e6kzmJ4cdYyq9BuYTYECdBFuy/CRT9OOWp7jFIRKI7BztnX+LcK9Q5WHmOioTeKglCVBAM9f1M26tn1atcr0kBSQqLWp0qJUUlhVXdpwnAJ3QDW4QCgAgaYdAGBZFiH4Y6iaJgamIaiopJ2i80KS6xOpMgEXSNMmNJv6LSehEiCdEoDpkKe49PE5OSkpLU+FLe6efriBvRO8pGT5YQur6PsayqFSyHZEEV5QNIFUUVkAuSFCIxrA3cTJha8Ijh8AVVeWAfyyTIKltagNwzf1a2ybI5vC7ftiIPOmkhrzHn9yAzbUncRZmJR5woVM2tOGFXKbkENGHXLGCMhlxm7ip4GRoww+55enJ+HIJdg3ND+GpTq/yd5sNXV97q0/AGzXeNtMOnVY5p5nYZg9Y4ZGr4Fs03xFY4yc9mf9W1GnPCGhys3PptzQdJS9s109T+qEtbXXbjbhWNr1BBWsEerjCEav8eqvItF3WjDejHWx4NQo/2Q+cQAXqUSCLZp2PmwbwPsQEC0SRiUQEmIqAJDwpqWBTnbUtbHu3mwmk+v0Ckmb+kABBOr5YXHzlLZhBOiUhdIEBQrjebqeuOdANuYGZmYHEelzHOxGWyKTkVzodLySxfqisV2RrgINeJmRRyJXjQ5wmi2gPbkdhk7hpkfQ6QYLDSWP/J+kseeM0DU4qhE0Nu09TWDg37Xa2zQNtbjWOqrckgkPJdPBJKy3lTjxcBU2+ufetW/IXKoE9TGmS5b3Dg8qzsWljJvmb1wMWtWhzmckRuvbg4eGULxBOl5w2b1h9l/jinTsEcOc7X2hNoW1lrxBiZzBls47w/L6IEU6Z08kUEY6RmH3AYBWABTc8n8UwET7sp6DLux8vWdS2Q3MDvgDFKqSQo/UKcuJbsOuTWO56/A/5wvGPA+tz+G7ffcUmZrLr07R9++6Wr8PrP2fiWi+8gdz33Humtlbsb2uzPrR88/I4Pvf2yAWHdwbu23rj/c7X1bYToR8h7kM38+rzF9qVL6tUFdWzJGIaCe6tXF9SBq9KPBCpNgY5A5ed+/yh8fxhfBtfRAHEceOD3Y4cHAx/BlwcCo35um/0V+TZ5A+j+7eWWZCQgC5j561Pog3HmmQQvn676k1E0asUsiy38pJkYgC6Q2YVVIVurR4nXAx5Dj3zbq8OHvXfCd2Ah7Pd/+MP+Kxx285GP+E9P6O9iCWr24+dgTMuoEa0uayG/BloYJsudELBv5KxOCA2W6/WZH4dtQGG84plCXynMdgmU0rzSokOP+5/rMWzjj68YjoF7vmo24rpjepNxFNc14RcN/5cqLxqArOTbbpNDmqBg90t+wxZbKq5baRH5urtXTxW1opFyMBaxTB93y6TY+IsqXFbTza4TCnAcXuqG2ezKJTfsVT+VPEv1yY0P/vvhQ794qPVb36pAQ1ztzA1J3pf8zneS9/375ZfjE16bYmdpEQw5zKc30QdpHgVRH1qN3vt02g1TOt+WtKfHMVc30NqodCHnRZAxwAQFFxmex5sLiZOnJRYRFvGe+TwCdEXLfCKYoASB+jefGGPudMFKFfEosDctHO5qyLjNsljfDjCbuLk4MYUugt1iPmdzEpWyoO2CVGEgJjdImLbLXDAoW68FdXjzsYcvvOCRm0bJyOse/Hv4xmONXV054LWSSVoc4xoqYcusk8IWHi+f628baiOZDS14imXBkPfzD79uBL4fweaBBkekimgQ24jWZaKUSoA31EBLc+9w5W1NyWQ5iZs5f5oFGrkPaESBGQc6mhvUFFkUsPKXEXTUinOCLnWTYCPOpuWwI8lVumBUUawRRRyTu27/cvpw4kQLdp/rIYZP9f3xFZ9jCj1fDWmRebKIGHjVWxvE78z9LDj17w8DUUCTGVU4IaCJULxKEkJTjUfhteQoYGLtac6SuJmX93eG6zvAAfBa7RU95jgx/RUNT5n6K7pj4pf9FjFe0Ty/yU/REQoDDAh78Ak2e9bXmu+tNpMFNxW7GgXoaLz6gDBflWRLkPdCMAHDyrUkALNZJsjwFZV3hL7+yr3f/I9HP/gLBz8A3UUq77jj6wHrpQ8+8vtvvj/G3MNOzUG5HyCfB13ULodAgK4HYYEOwieMQ2yZNs+Y2yB2GrEn54Djpv6QdJ4IKB0DoWtxS6AYrTPMyoes5tgv6vqblbq78T9DBETPPd/E8cRxcgllOxJ+hl6GypfKuU89cYI6oX+4j9Q5L9xLjPD1QLX08CZiC9PnEdVWsSLWhwjoFBsVSRSIyDzDDOiVY8hXFzZ8B1DYsML7kOYCcATUYFNhH0IykfnyPZbZLirmOmYgHbSqC5GFKIiLC1FdFLtaHd/zqIqmytQaUQmJ0xFsIxnZoL+AgJhAgUCALWz6J5DfbzAFJjiBgkFDqrkK3MJqUecLH4FqQHVmWD1cjdnFbFewZ/6P1KR8219eiQBy6gLO9FkrAy9XZXt8eZ0ACCqSX5kG5ifJQYkls+UJBKoPcJ+1feg/0O/Qi+gkmkV/RL8D2vkP+PwKvQQxL0P8yzDqP0X/C30ffR19DX0efRY9jZ5CH0ePoL9FH0LvQe9G70S3ozejv0Y3o6PoSiDwDOD6ev6/E6XhfzfciYit9bh+nJW7MXe35vZtt2rmXoOrX8WSE+YuBNlUL3fB4osQqSTzuWKLGewegLdTu2fxNtzDTakg84mTYeXUni4NlfpYqDclMexXdPPe83yOeYHxVZF8jt2wSGbmhthCpphzZLtU9JLx1y4J+cmSEKiYoudkmTSxFceleTc5ZjX5Nb3m6Ngll4y/9jrglFpDKOzogibZ0TpHVonfClj1BpUJuVhRxDE1GPO5oNPLPk0T4nWyoAwIgi8UljoNXfGLWsBnKD74T3StRdcJSQQAT0qmqlGRmhkxFDIpqQ/5BVGKNNB6v0LrfLGgvE1SFGlM1zeBumHGaENEEtV+yQyGlT6RaqopKUGfGzaAj9utNhFNxVRNPaSIfkUnihMVraAh0rDm6oDm6+KCrvpkVcAjum9r5Ud9k319k4d2Fwq7C60bWlo27BzOZod/9kN9z4c/PKX+m+rDpl+WqUoNAy6y7AuIOpB2VreCPoPIumT4/HpIlYM+kSgF3fSFcz7BdtKSKUp1voaAMiaqqjimi9t1U0q7lkBIsC3sN5QGy0eIYAaTlk8yJCjTUDsUjQgxny+UCJoCUQugP6wURChMURWxuc6hxphpjqlGgz8qypqStlxR0J1owDRly7B04Fi+oKSEgVXFBPLvBWhVX9/uQ5OFzpb1O9a38Mvpe9RWsT1qhdY/b49aX/4v3qNW4vsTmDmi6oPo7VNz4+Tsu9QaO9kuNUEk0B8CVSRvp5og+gz5rBvVmjqqG9UIFiVN/riiyZLA96qJLxmiIgtc7t1LhmkTakG96H1P6gxfL2ApzDy3APkIGAmMc3E3lcCIVHVkE4NijRMnlyWWmJO2IO6Zz8TkZuvyEili66TTkFgUhXFpwT8OwJS/rbWrs7W3rTcV7lolM+cuzk74rliZdXKBLRPwjmQOSinodDvFZzDNgWhnqiB+aVebMdrVokgk8LqAUBco19U5RiwaKw9HY/dJl26YvuW2jgFh1QR8yE8GbyivslbFk9FAzDQuijp9ATMQ6oi2ZJo72nIf2tA2N7Jqd5EM7CnO60V7yGeBJTvlsCGQRR6/VoTvNHAsWcWMPXlaCHU2bKi8p/KeDRsGT5T7BwYfJbeVP7Gu8hTevO4T5YGBvr6BKh77DB0G/YZ5vY88EVbmcUhwAYdQXAUiznIgQjFHImVfpK4xVpeKJF2+jlzqwqUwg0HQYwAbqKdxAOxMZjwfH0AqLUmt/hvR8eTN74yNb5Aiz0fHE6+7I55PBe0mEnPJP9lNTfY/xcaTWEhoddNPJrX+8WRltsmIXPhUC3y3xeNtTVD/uVOP0QuoDmiyF91ZVuO2Aeh53vsvxVy1EGbb0AG1H2CbzyeBjgxmxeYb0oNCjaKaliWlbAPK3vkcDIZmliWBAGGeYBRmyHi1RCqwnSmq7YKqGGEuYek+kFu1/dZZz1elEVcdVdaAbOKTE5g8U6YZvyev1w4c0LQ8cOUDB/S4ltN1+NZzWhy+ITKvfe81Xz757GXSDZ9++VPH/tVkTxv0Wiq4XRp+2zXPXH31Mz9nF8T8S0/9AfiOXvUvXIO2oQvQW70e6GNGXKIqTOVgO9KZqxubVdzvG6M9qOr8xfEIwwEyxyP9zBYsMVuwjCQqS9OnFcN8yscXCuPeCRgB2YSmzt91ztiWQvVf3mCOHczYz8RxoQ8Ebc4BjQ9kuhcuQZgvBiSqzxNemBlXWZgZY1k4W31eSnj5U9Uwt8nFm5wTgA9Ou5KvNjlzL/IQcd34XOnsz/CS0N2XOnBrX+o0sR3zM+zLnWFPK/+46AlphidNDrtUvrYoEVbm4xH03JnG53JASLej57xRGoNHpuI3T+9mGAaBDcOyUQsEPOw4ggzDN4F8vmXjt535LxjMf8GHDMlnLIzj2V7kjedpr1sY1/jb3/KGW4/deO1Vl80c3LdsjEN/7hgven7GMT5DerYo8KfSs+el6vsWLyKclSbwwUWByr1ne8IDbBTPmKr6AC/c/tco5i8nKy53bwK6Wguj1ca8ipvrQwC/gE+yrbPAxT1X3Z1M1OxievbmMN89G0zgIE6lz2LgWmIEw714snL/T8lRMjpKSIFIdHQr8MUS4eEShLeOwqVASBZHZ1di97UCe6JA0moOBb4FiRQJGRsj8FXFSUeg3tug3iZyUG+5S8Ws2uGQRgW0HvR4uqTuhD3dzLg2EoPs5IZCMA9NYGc0lBxmpwR0VHIC8i/wRZX34w9u2rTxEJnpvvHG0bvvfjv+IE7MxnEitflro5sP3/nOA93X4ekbN99dGb27itngcjv5GJStwlzpKLfKEsHrVZCZw9yzarzqIzy1MBeCdjjADIYMzgPplYLZdKqQ/82eW8gbdl/xwx+Srh/+8OZbPnULvnxu3+UPXLFIntkoiW5+Uq7u6GKyrJGhGIE72rFNITM14y2dXOLOHluejNWI7mWpmX2pEWarUNtNxc+6AFE2Xi2GUBBeT9uua3nnNiyXWtyz3V0sq/5Ry+sx/SfH4JLXtOdARuFu7a2L5BP+RIBJsB8fYxKsEVJokGDLYpm04GetI+lxGTN/jayKAcy4Ki5herKj0l8pteOv8At+FoI0217px8+2V0oLD5Zg6n4gh/HyjmZMpQIWVbKRnWAhC6DyysDLZGXJoUiI+WixtR2ttkl6bOvmkaG1g6v7ejtaU031EQ9r62fdMA14cBE7KRWB72QWea+ziDTvS4hJ1aJti4v+whl3U18lC9ohN5l0r1KBAiTxqvZVq9r5Pd4qf1EO+46rPp963BeGwJk3V29QKE7UzbpJTfJJorSqfbZ9lSb6pC+qkMVULzbVN6vmxaoJIXVJ33Wj1ei13vlXrWzZhSEdQWaGFm/DyYVMQ0FUvHDxwQL15XaWVuJOQoD65Zk/lXqy7GI0sKIv39mWTjXGI3ULZ9uc+fSBKuDm6noVe1eXbOi8xgza85n7Et/iNK2n/ki4aV1TOOKn6xvdvnZcbO97TXpw82CaX87chzu3941oQcXvV4LaSN/2tlyuDa9Or0mn1/B8aU67D8LkC3u0S4B2Veyt/7nAJKkwV8/c98lPfXhrZb+s+WnRNBS4szye/BjdXZX1h8tqXUBhp6nU5jvz4+RAlc/yIDOGBlFtlttsxk54D6suLByi1i1hRIuF8uRTTPryXSvBKiKqrlKKy8J00gpUfuy3MKg1DX6noi8Jkp/NvmQ6jklD7LronrPHU3+ANn0U2uSdqfZgOdCPRbwdFC6/z6DA/+eVPQExMmETkVCJYU3PXG7M795faGzytMSUseM983lEbjjHAEMwKM5nSjy+sIYD8Dx02aUH90/t3XXulpH161YPFBRmv3WYnsKRZYYh8r5MgW9JKBUzte+Sd9MHSswawnTBQeLavMuqWSWXE2UpXMw6ouQwNyu+26+6c6EWlvmmhb9xjLu1cnpurn273/Rhxq2FkK9OBH1b1gyHYoEQzadFQZ9RJA24lQQMyArYMv5oa5fvvVZLX6Xeb4jmEKGBuHi/gO25TxFJwecoJjGIpFY+JptkgCoyPkc2qQ43LIaSjY2tFbm5B6/qSCf9Plk0BUmK2qtsydFVnzVoiXXwfp+5zhYs1ZD1oGZpIWYVwWK5pSKty+CgPxsyScYXVoKyhg2pmV8fr94bWFO47fcxupWcgkGwUAS0sx+VAZUQscExgQ2TCIgaxNRKJGz0HKAyzAFF9BZHRIpmqtuXma7GfBWE80CA+biyxsgne3pqwKQzZ0rOCKj5zMkl9n4snM+yiVy/E4lY2+iFqCclIZEg4J21UrGwZZJREEKJpjo34FcVaKJkyUBBbinLXM5xH/AnDAwqz6Rl1sWpAlsbyHrA6au5W/Mj+AJDFCrfEHxAsN00frLSc5Jutfae3GutdG615Pyt+VUbiWQIlW8KcMVdwpUnK90v4rsb7L0v7rHtW/lcI1VdYSfKgp5wXTncAoIiCDK91EUEksCiIFQXfTPLPfb59NkLWoC3e4PPIbYE3Lw8IWabtGvzjWeQgHlrA/XpQjGdZ+tONV8GxvJKCc8Xhm/KCVqc3msQOxzk647YWzAtMTzpMZvQ1FClZ2hqagi/iW2frFyX7sPFZvx8uk9TmhXtBSemX1S5UwwIZUnCl16kcy5k4dETPM/z66YwT9eXrvTwnCcUgBj/zBgWMSCjJJVFk2eMAYta4LkKOoweLtsHJkfXCkhayQ516WupDzBz1TyLkgAqSegI8k6gmK4dXcePguEe9EGywKKWJ2aWLbJnPg/iLKqWqLaHjJ37Nr6QhZeKCTdH7Tn/nB2bRtrbkk3hkOydJJFknnFFpjwxqxTfQmfiLFuJZ6KRez+BeKwKSeajUOInmTAtiHG0aiQzVXM//pX8kDfH5RZrrzCZ774iK3dev5PsunoXjinyJZoebpFE/3afLG+NRFVZCNykGIF6d5sUkDY4gqi0aH7loKxgTbxEMd20l1bZWhdVFRq8CRiCP+ZuE/3yiCUIqpdYw1Mrx8evHR+/nj0PxO36HJCWvR2Lq3zKaCygyRerxipRKsdh8IycP1bvx4bM00aiTZ2yIVvbFyXVV4riUKyaNBrAtX1XMElW4V+C5hAv1yPPl4ApxeMLYrFgcdtZVZOp0iRZydbuqkt2poO/wpbvdL6cxz1/EPex2MmO9ENMeoeRi+pBhqdQHpXQSq61X4XvLfvWpklDaFNnM61PMAcMDQjlg6g+EU7Us9WbSEN4H3IjPp97gG1BJegA0ohJtAPIjBFzH0qgiJuITEHBPrXRN4UakKo0qFOoDtnBOnsK1KGg7PCdNLJoyFNA0qKggPyzkF+3uKueTgP6FPAniiXK5CJjd1MoGm2aQE1NMPdDofgEisc5F4hNoljMHwMyPb6oiolwZOb/e3WcLA++5oojhy8+uG967/m7ztk6un54zeDqVSsHVvQz62xvdyto+4nFbujM6af6L5AUG9rZBiH2yS76xsu+KXPxYYdgANYs5XNFvCh9qfrMrT4rBRfYIPfm8vwC89U7kAs5Z+Px4186ceJLtSu+5/HHXzhxAj98/PgLjz/+TE2Osus9POqF48dDmpLiEjWlaN/tiM2+1NDW1jDSl25O971QbE6li3hjQ9u248ePN584caL5+Nwzx19hl+YTuOc4L+04y13JwLPjx2cWRXXMFVhR5KsNbcV0X1+66F3b5v3sPPoOcz+7x8uGLRKZNPgI1WuEvBbJRKXMz06n6j4YRqqzfYiYisx2imE8LwAZrE0gTeNjp0wgReHnf0oTIEj8zPQ0zMog3O1OJ6o+A6UQnc78ZcWAMN4wvHZw5UA+XcxkMs3BADMjuolgorRUDSuml4X/rEGjodmXvstFDL/gh/lgvMqIkFUzx1mipZezd/qC3p9CPeiZsuYDOd6IBbrg1Ti/lCECzuVdxCW5gClfKvHseWypiB+YEJxfs+7+0zlB+AnS3vkCmJW/8KdzyPBMxtMgyCR+XDB7nyAxq7du26nmdKrZ4geBQGfLqfkpND9X2AGabMIU2GWxKeF+x7zdMTeCbL8deK7lXwicWGxPGBiBp7dzdeR2y784kF9sVWC6yO+gT//v6t70PNpTNuqDgO1Uvtu/2q8NDNqAysSc3big5psDuGccWxooR+efc6i4Zz4Z2zunuv1Z0Ea5lX8RabHmZas2AVBUXY9DUFAwavpFiR+wCmJGvpRhHriA8JTlGyRFBMh9sWIo+GHLVpOh2ftCSdW28MfUZCZ5zmFGSHDBxncBSLH+V06JCpZIYPalVCoYwlYglaKhoGWx9kvMF1DohvYHUQ6k0jDahS5ALz21zSSmnymZzLcTGqT4FeJnkESWYM7JmiTvQ1gz4C1HQHL6kOnj+E9knaAjDTObrx8ZEtvhVrUtL2wH527ffGXFz7pvanHxSGT7iTT4m/lvesFkOT61d/fkrvGd27ds3rRxaN2awYEVEduKlFLhRIBZmjG3C5f68kBhpVwJUHl193m2b1CESOIt6eXigov5cmkxB7QnsX2QjsiMxpksW+5z8rlB7Oay80m27B7Y0lnG64W2dYlMmpJbdw5V6oZBzzUCTZmBhNTcNbJ9Q6Q1oCT7M00BE899maGda8fxm449+jpy0xM34KHBri0rdnfSdDox3CKs31h9PkWHOzq+5ESxzw6MVc5fNza2Lt6/rr8v49TFosQJRDXiZPr618XI7R6Cqvxq8hi54anrpdu+1d6Fh+nasYDtq6vD1ceL95U3oiRKw0xYhS4tH0phBNSqomwTkUW6kW32V0UEohtGShBltptRUwSNuUATXQEdoHpqgDniw7peW4/u6wPcvKpv1coVxUJPd1dHa0u6OZmIuqahSgiwJN/wnXPcYG3RpmpnYIo0P9cB9Gc/zmM575YKKW7GDyaA/+Jgitvsg/TEwnJL5RtwcQI/8Redk3CXSWy8//7KPffff+TRF+LuizjukMx34+5JchOk382zfbDJwdc5Rf9PAk6T87R73f346P1fePTFFx0o7J7bnWJljNx60mnClbs939k/CD3Ag+ugj46VjTaYZL0p0ITmvWdbkSRiUcJHFjgkcxSdqS0WYuyBfcZFu8+WFjRPIuLTVw3LWqql6FigPDK1irGTeZ4CzLO6XFgUvY4sgbaVBbQKPcgutiUDB31OU45ybnJU0cRnxAB88IGbds8dv/hOPLYOP3Dtee9ItBRWjrsjU3hU0Z5h7OQZjSUTn5GunbwJ33HJyE3xumsfuGh7anxlezJ4bc3/9PPkPXQYQNvIk3jR+Ve65xHvOeltedRZfL6Sifj5Ssvg9uTkE67LELdKvNWDLFcGvSUF8vbKd3Grpu0F7F25CGjs/Vpc26uRByvfq3yX32r4A/CN36/re7X4Qt2urtZN/a/WLRbidaspqWrVu5iZ8shhqFJM3wvVaql8j1cAKqLhQ5ULvRrjVtziJWAJ2atOVU4dxr8HempC55Z1djxnTGMLaFViijIva0KZoZ6RyAw772yktiHhDA9rR1pOPlVXLHIvZJAoWEpl2WJ71U0p7M0qdrIY80zAL2lS5ZtyQFE1ctmPiKjJGr2CmMrTukmm/5dIdOLovrkbTEwDCv5iP5YVH/5HRTM1QapU2AIM15fJc9RANoqjpz1TTRJ0V6jdAX7qENtWVtOKoY6T84Y7m9tdIKWImd1FEDnaOHNa1h2J5Wn56/fOZ2HiJLs8TW2LJEs7Xi2ToK3MQqOG3WDQ5WfjpKswr2+QsqMhc3FKgZF34SKbMxt6K829G7S6tsHOTc9tbluXiSm3A38Wbnn4tvWrJiZW9YzvWtWCR0Yyg+O78OcnjnH+XaO9J2iAKqiI7vPa24GIKImEn+8uShwrAW4Wp2vbRzg+4+Pom29369nyCAyK75nPSjlPWZYWs1MK6fSSPOPVdwjc1Kln3Ew6bNtJhslYR/ApB8IMM/egLFuTcFzMz6bsg1CV03D/fnZUXZ4RPw3sLm/pr4ytuenRMt4pJgNi5WMdV+/EbfixVFdzF05V/s4MBxzzp1KzKf00Ve7sTeHh/q1rJ0r4RPnRG/CayiMiaF34nPbxa9or25p7Ul2QwHSS/p9IEP/TZG9XGcoo1nxrR8kORm/lev2MOnusqrPLeJn3PVQVj4qVP4qmFJOk739fkmJiQGBbQgZkFi3GJFP6/g+8x5VZsfa+qdr76Bnf50ZqNgL3NKaFp6rvMaFAiTkWBYSYRICH/+D78LIYvFtk9ieBpfHWMx8lgzCfAiiLzkffKQeY6y/euml9MdclLexi6mNbMQByHmHCWJCZRY4N+cyiLQlcE/IQ/8QSxN/7ank55t8zXwSjrNLZ8iiI7cefXsgrS8LO6jsFiVFYYOK8teXB1SsHom6zFVLZuiGDSdzPnLn7APJy+7pI0iSy1UgAHRe9PdeWDDGMVVU/UsokmSzLWGJe/ezTRbJ81sYJvscwTLKqQTaIosaKHROZwdHR0cEMzgSDI/LNykbJkTIbV0SSTTTq80WU5ojeletRo81YjphmlCSbIgO57ZdccslYkQSZ3IvEtIAWamtoGe6qq+sablnREQqfu2PHuVJU7Fhx3pr6tnX1/kbL77cbAj5fNBaJkSY3BkUHGmy/32r0x8od0TXnlaYHm0nLwP6aPfYx7rsRRCX0ZJn5VkoykNT8oLYjWWR7u48wz34icDsgs7PypQpB4ss1xsgS7vDqWRav/vSclrrmerP8NaALwIBuZgyiOdySTGXrHMYgwpYcrLpeBPlJlXxxSOY7fdiqG8PSwT7PcZUds8vsinD3eDPoxqDEpNoGOmif6b9+V3JDbnt25j2aCvpZ0Gi67eJVl2ywBzbU9zqK3yJfbLHnVnNjBPmi3RJva1tXOc8MyGvr4nU7RJhiHwj6lMBQU0KvM6MGU2YUjmEn+b7pKOjIk2gKXYquQ8dAV26yMBEuPUyoevWFuzYJEr08QzTpWB/RtT1YkaXq1u9BpDLlD2SHIouyIrJzh6lEeK9ousSPNpIVnQHf2lZnAy/eI7jqtALY0GJh6mwFLc4+WY7W19904w2v3b61v5Trac3Wp+pT4YxVKPrYhOG7oz2EXLWju7KdZ66a4SD3c0kEMUd6riNbKc9d2XNpJpnqoSs2s+kCFGCmC8/bWJIdUG1MHJbcInNgLjERmKXwzQ62hOxiJsW8p2k+4MTduRBHzPhlgMubvynKH5e+zEB25Rz8cKgh0bQzqCoY0+b6zc03Tp+bU2QT2iwWuxQRNzRmLJ+iSEHDJ2sixlhurPy2obuh5buqzA6TIBCzYfQcLKntMX9jEE/71rbVK4QcC/TVzR3jb6U3cWSf+WZQ+rg8+yhZ1WS/OHsf3mIGhXpfABPbCfkSdwgykUy3Pwo6L+5eM7qha1fMUYwoaNbD2fMrv/FtcXL4N25OsIhDCcGGUnlb3C8q6dU9g40SFLPYzhJH7czvrYpS+BnUR/hvWLADjebt/Kd5CSaWp11wE5w382eXp6lZ+8/oJ+g4GYsfHVd1tmDyN1E1Oibm3QSXmkr+UZvjjoDa4cpJb2G27rDnMTi31Pliyg8x/MFhz1Zy2Ms3p/mXGEuYXHpMuB7kkoI60DacLIc60kSTmxpNKkq5MFGV2rLICNJkQ9ZAd9d9xKdDKw3k0w0fI3+RSiKfDgo/jrLGmrjyPgnKe3AEyfK8ccXr0aE/tzx2XI6gqMyFQ5CFPQvFsz7fdFopsibIOxGGZD52ROirFsrrJQtMooFqvHXL5pH1w2vXFPO93a0tzclYvWuHApoqCkjBCj/Kjgm3OJHEPLMUMn+yeSe0ec+0qvuai7nhqwZCRTfHf4eHe/+n2ObgN9VUePzFZ7i59xlDmlG0L3EW+SVNmZHZkeBtDbdnVlTqhnYKRiieGUjoesf4/vEOXd/Uc7ShDU9VLQubTs/rFVr5XEMH/qvY2FC8f12xPxklWhL+acW2hur4v6Y6/mM4Ww5swkhtrg8BSMhh4G4w+gF+ToUsqgqz+iJF3actGmLvl1/YoYKiyBfH+PGCi4yRtrcVWFRFbvBFoopm/qICWrzd3UsKmF87E/nuZDaekiLt1ZYQR//yTOzgWIVRhUIlZfz0MvhbFYnrEfUYjWwYHmKkkM0kE7YV8HtEoC8mgmXOcGdwmAOZwSbzYiJgx9QDCZhYttwFGiDCW0RxVPSLb3kLXEZF9r0kXLnggG136b4lpLDrE7t03R/wm9iep4Qn3ywGFgoIiG9+C1y2eOEtcPuWA9Yqu4ssIojhYU3w11lxu8oT/kBPkqOI/XpQHpXLqwHRCMTHtgez3/cCJgYIo4Yp5jcPA+Rl4Jm5TWNxq+s0W3adw20amSyDeV0YkJ0kA9sv4r6MnGSuPLki1zWKogXwsqmZ77LpwILr0OPnvi55x/N3JF937pZ/xcKPKk8H9A37A05guEcP4H/Sxyq/r/xz5fdjuj6GFZzBypiOB25bOzB08Z3kHYeGBtbe9po3vhFvgrT717OjZnqGA18Lh19/992vB+H7urvJ+49xWymzkX0R2voYUEgUDaJhdB76bDnaV0+QcI4EeuXOIVDHt69rzSqYofzqGkgL2zzAfi4KC+w3ziT4m0EShT9GmAyBMaDuozXyb51PD1j6yJ/MALren0jLjqg9g643uiXcFWm2GmSm9DIwwDraOa2XS5YtET/mJgOGsnFtYdjluA6oVXbCwMzCzGOSHZeU4mvJ2RI7Fw4X23v6MYzHFD68aCyeW/nzlTFRk4fVyPY35IAeZ9+dyzWKGjX1Zh2r9sSm9wmv6E52/Ac3tV737Pq1e1OFi5r0Q9tSh1ezUXoHvnjxGF0j4EOV3YdyalbS5Lbm67cG20K3vkcrqpJkSViszI29rh7XRabC4ebO6cObtdsO7S+vab6oGEaLZbyFEmjfkz68cPw3p+uq29Rpa/ihhTV7L43nUDW/AFA7Mb+2Rv+UbcUcvht83r9/kWs/XiSw8TsqmlYB0btC1x96SNdX6DH87UVyemSOmbw0eBzX4HkMEuDEYgG9vE3i/2Cb3PqFNi1p2LI2/bHWGAY7dB2agA8tbhOLZ40xVnhtn/uTbfqrJ4OL2tR4OiSrnVaw2Nc1fhoag3lRS8pamjpTgtMmztO2ZbkO83hNL2sw35+xBHq9eQVvqjdaMf1haOA/L2r1CxBp8N6Awda0hx/W7jh7m29mv9iwuM0C26d0hPOBP+HfuyzZaf69WKhtlfaOrT7Nv9dyrWWtXeThm148xl+e88b3oYc13h4YR/y+Rc09WtFq7eTdUdH+fQmu9HTi8/n+nI3o++XwUJpIKpOSLmgGTKEQqq0vseUniRkeBMKkMZfVRBXZukPN0lHbE30GF8HcWbPPG0w8l8Faad7OleWZAD3ICt/B4mU+yzEQwGvNDesz6XQxnSlYzfzoF8s2OfBjW9BrTk+Sn/1KUG7e26a27wDUZv7rGlWvnVKBMV/uiOPQLc0/ee+O96waYd4m5iumQ9StLftLm2/JSnWCAcDOtAJe7M4rtkCkKxqXA7pr/t/v3XE3y1SHRYrv+tTgihGdZ3di+tbmNrx5UOv3GfgT1ZitXlgSqikX9iQu6Nh7n2SKde3ktDijM5Eh5nn1WGL67URNPY4tVodZwsWPob/q6+dVXvnPVHlfRTF9dQWy6iP3QaC/TrQOvaWsrcSClMaiUDPC9yDmYi8Dg5AA2kjVA5X5mvdiT7nFTnLFV8kCtCLhxW6nk6yMrSCeLdfOFlYU8nx5fKnfHNSeCeRsZpnvHLevuE543tS5cNaJtch17vlUXKVyPdCyz6j6wTEPOrFZkqmgv76ywtds/to0V5vN5t/gQxAY9OEtj8170JlCWIqJmM470b1NEVMSc/msDJjmr3l6H8vogxLQEh+RMD83chTdXg6ngPRGNgJWXrd2sLNDk/iPTPqgkzsVLItErHYZP+WuirQXjlUCdjxvaelakp538Z/KMFkONjc3jzaP9uWDwXCmkFeZOr3It6N2qrinnSWCCcrpLFvd3enHtnccZM77xQ62RRamZrbkSrJbYiF6vMmZC7H9NIwKA4/43ZGTTlNlnDz3wjdl6REp+G5B8b1hSNJEUZOG3xSsCxw+JFOfIfv9I1Od77unsD7R+wEtMxYhybmj7Dfv6FG30Qk8EihuaXJOzt5HbmVkK75MZf0Nw6Ip+SVTXP+mQODQYVEK+lUoZW8XK6Up9wE5O2bXfD9nyBdRFpXRynK/xTeKMEROudmvSoOetsssD0tcoJ1UJN2WzjJQnrYcduIe65r5H9Z1eRT32whyd4Y48aztnm7r7aICKMkWDvAB9mNhisLdMU8o/FgvFuRk9IREgAokvfIN4GaM9ZivAPfB3XoXCYmmKmCgvzcOTWmKrko+WQGgWrkeMgpEwR2mXnles/zHHfMFv4WPM5YHEdV1l5/Rp0gr2ztdjvr4FuKlv9tquSHvR3cWTghy1dqseahyEQgttsDI1/Ba2LKdsUfHt1f26Tp+HwjuPbpe+R5E63vYQp639/YpssF7n8gauOxMItfi70sz18v51cPqwiF9aA8UWfle5XvV5cP3s8XC9+szezQNt1a+q2nsOX6/plXXDfnYkluBZ8moEZ3v8alGbxsFOx8Sift4KrKn5qnC15vTS1N4jnTT/DfB2dYohvAQILyymgqni+EAMzmF2fFkJnbFRYzYzXOzL/d9ehw3MJcE/Pz8dsfgnV+7izB+/JFLV46T7auPVz7Lt6LhdU4TvvTgnXcevDRes4V/hm7lfrYNaOJJtAjbBaq1Ict+apYtyOIr5h8ifvAJj5pf3ZtgJYP0fbI/yjs8zKofJ8XaYVBduLbDD3r+lbaBDtIymCHnWpWXnJVW5Uo73tbwYsOIjW+3yES8jWTKzVJP5Z/iduUlGyLtkYaTDW0YglfaVR73GMhDHTo2gXrRevTTcrC9LZUUFJCKPhAkWCEbanYNQVZkYf7nrkWVjYGCqKRwuzBGEmY/ZsP92LiJnzuzBNVa44t/VgFsg6i6Z74cmVulz5RRQ7KgydOnF0BUTg3s7Ujlqzfl1f0FN5MPhlcGgwGde84VEmI+2Md9h+X53bOpYL66g1amVceEmvPj8g0kjNe+gD9WOQe/PGKI7xNjStzlhDIyAqTyDSCVF5hditmk2HX/vIwnolv03xtw5BdewC8rUfleycAnGds9OVfk3zjO3LuVEyyvNvcKiyIvOU115vv8RS6XTp069ZjQzenO20H7RNltsAim7Cgx02eoAkExG4RKDXdmEDuDh21bYuZhjKZlTClfUOMmqWXHDqSWp0besQMLmah37kA1lQQPsMS9wavJ2cEDaPG5A6FgoKs9k4q4gcZgY5j9iBY7qMtkvsgAwO1EoeSyA3o5Ky6xX72Akam505SqyAkfGNw9CH9k1exLJ3bjBhyfvZXb/+hR1lM7+tKztzYXcV+aHk33kWDnIFm3a50wUHnllZnHJ3HDcU2Z282Hg9ynaKG53Zx5k/vYV3V/Hn4zyPom1FfuhSZA1Zn64W25wGxBfoYvMJEZz4GOnxtnJ9J2Iswt29yRh60DzntZr8QM4xXXVBdR3+SYGzcyh/3bgSPfDlx/ZITx+9uBU96ukw+YDp57xoInug4JLLLKiutv1+GPY9YZ+jO6DXjzZrQTx8uhndvGqCytXkWo3FhHoFbVH8TLwwQALiEfYRsBCfBJ/ssZKmYL51BxWa4BC+ZFUNvV5pl5+hZnBUB15M/My85xLZwhrwxo8VUyL63umfJhJFMsTy3Oxc2VwMnQju1bR+3N9uaNG4bWxeoXjuAWk0t/9jTAf5lMclyLg58C/9nSNbiKgrwf7WY/ycH/sx13rpNnB+9AJC3l5ZKcKuHf/fXVV64bHl535dXYrN39VjDcTLg9DEI8FLSNBlWZ7Mx1FjuSabe7W/IHpTqLCHKCnUQTjDSGpdyO3MTRyOC7lpZS+S27O+VGzCZD0/SEaIb259MNqeDK4qENjaqsqXXR1r1Thlvva+1eL7FfUAJ5AjrIio/uN759e82udxm9jePURtSOSoCWpst72Q/asCOPp43qr4tO66CIq8r/U9u1x8ZRnPGdfc3u3vne75fvffb5db6H34kvthPH8SOJ48R2go1bGlow4DQVUNqYpiW0IaGgIghRSYgACQVRGoEojfgD/kjLqxVNqwqQqCqVFgla0aIq/xTqbeeb3fWdw5mkrXpWZmdnZ+b2JvP4vpnv+/1YWSM2UXS0bUky7Ny6u1qaY1G3CzEb+rrK3eVCrrmzpSOTjDbFskGfq94dMUkAm0VPBgyw40QFABlVuLQKqXXiTohDjH2/eSSbHWlWI9oV3WaN+F3qw85AwIl+ZQ37nWr75fE/heOJrkSamyT5V/Zq5dgnyXXl/UDa78/4TwZTfn86oF9WxhPdiURXUtf7jDGUJC10uFwHLE18e66NI/K3jkecZkQy7kWKiyFw/LyEKnS7oOdho+MmjYyA6cZpihAtUZ1ttuwHGupCvrU5k64PuZPeZJULaK1e6oxpxrUGiRVXSrixSP1ovdSWuJip2RUF9QOAOEU+Ena/OEik4XvN5uMC5mp2Ni5Vp7RCfhKob7788gCn4Hfj8Xexwq1pJ2C1O1Q2p5LUzQALyCDfaGAERNQmGK5g9LGoOyFeW+ElXm0owCYh4iPd5eVFfmk1a1Wu2TJpJWBBiYSDPgNMX1q/jbT2ySQ6cQln3Blvwhur2SqnV87HvOgdb4w/s/PY6NiRydPHUEPNFkHf98Zih45NPnr8+KOTx8aoXfW/SPAe+xhZDwrMHuauF7Z2seTX6spelhE5noP/fyJ7IE6jTyX6MVlYqRyHwYtkDwhy28BpmGam6+mVcs+WfaViPLZjYqC/uKe0pykbK8QL4YBPps6bLg2oJ5HOrP7pMxnMWF5EdbtiphU4ujU2ys48NUIxdmGgxAZt6vMm4pi6FHPvKAoemXjokfzoaH9/vi0Z8nCKwpV3nDqTP3NqR1mNjm3qT6XTqcMnD8Olf9N9DYl6F48trmixA2/PJW2KNOeP9eTM8VAwGu0kI9lmla8dOGQWo6HWdC6ZCkoOh8JPDx2RpCND0+obUMnJTf3k++CSSr8W9GWd4TZ/fSCbjRajodI1HRZRDrscGwd6ElTOrvTJHT8N+D1chQnGU6Uug/TMG13PpUO8zlcnz5aJjBRaSw9eq5ehTq6AcGeiZsdS33vqWB6hc196onZvejWq/hY95XxN1xGMd9/BHC3bxoYDbjJ7dxVaG3nNaAZ+RCsRnIguCzZvIEoRSYPIG7DbAsNssbIXsDquUrouKBIFTeTEJVKAM4ZZJR8dWUMDG3rbc+lkffgKI4sjYjDgyImJDD3pIxqGFXV2eMLa6R4RjCkOXK926kdEG4COo/jO8drT0sdW5f5pHsvnTsnyqXOyJMyflm3Tgo3faZNPzAkSeaAo9MHcKdm2k7cJteerr5xTJGHmhGIVZ0ieaYtwYkaQFCj8OC18Qqt1xqpoD07zPLPmjMRK+s01/5eDBHcpSY1UwQ8kpisLsc/6fKi7qLcHeqaWn4dmtLDWs6Maq6CPuZ6ZLe/ZTHrENal4jAhK7DARnARE6Qw0txUeAzo4mPtglnLZYp7Da+AIQGAa3bZ1uK83HDKA1dZdiDhwAejXaGw0RD8yqVDWAqKI9iPqaYnFhJMmitBLCrCvqxkOgn1Opy5VRTSi+HRNCLaLkd19kVsiuyM2K4tNCkoFBocCt/gdjsLgkH+Jl1iM6uqsrwS0O9lsrTtQVYJlOZ6npYYGaana8AbBSN9uUiRia/IqAq90ZkhO/5J/aLAAV97ESmRyRjOQegtvsvDcUqWAxMLmfVUZHR/lA/Q6Y2b8TBo4tEVqvDxFJ3VOn9SBY3OhikM7GLDUISYWDaSDaZezzm/xY5ExAz2mJknR7gJQiLF1b9AlSuDQA4H6YCXOtVXi6HU9sk5g2JgZXDhJppkpkv51iDnC/L78bhTJfrNfNpNZyOvzij5qpSKBQYkUR0GLFKREZgGLdYEJxJDJFjCBb6NdsdkXGCWCBIcizDMOxsk7nEQJDCPOBZT2LsbNutwLDFuPsIfF4C7pJdL4AuP3G/O2z8fMhLRuurxcKrW0pFLhMMj4y0eWj9z17W9+/WsHgERh/3XXzs/tm96ze9f2ifHR4S2bB/s3lvpKfb3dLcWWYqE91ZxqbmoMJ8PJRMwdcocMTJPEurN8nApXpYx+xfqVW3u/AcFGEbV+udprhfmP7nXr9dUcBeoxAWOhp2edcCeEOz8/DDrRpDMYdKo/dga1UrXHwsNYEb1bILhXVLAXzUH0OFaw78U2Em0jia2Y/hON+zaoF/2GhEehiL7vRfnYD1Gf/I3l3j7ECE3ZgMzzCGwmBJajdKg80LAZxusaHRvHjnV3tbakkuGQ32cTQajJa5pXGMFmdfWf21UxQva4UbtXS+gkKQnk7gAnRiLksL3jY9/Y0ux0x4jqaKqzu3yhaKqxrdijWAT1ZaJ3bhIsinr8DNy+hMg9GiAJZ5zodUd4sDHbQtZGXhAlrEiKJGNAaX4MmwRkFqwYmQRFUn9x9zwkmBCkmBFJmr/bljf0riXufTqWGpkuZjMzAXoX+BbJ4FskE91KlCVgFiUqGCvyVTv7JhD5ZnQsnuEtPd1NWfIbmdFtWyaGJ8r93Zt7Nrfnsl1NXdF6d6OnUevH1nW1W13wW0NEboCr6pyRmbXAqwbl6N+r1u1btdit31vcN1vs6CjO7nvLiCxuWx4ZWX6wvHFkZGN5W+tYS8v43nEStATS6VI6/YNa6/YNa2qgkTtIHcsjqSQJk6kb9DpI8GXwau1IafLSm6Rv/ZXMrR3Mt8p1uQYWcHDMHLvqJtpIVjuG4ffDLItgL5gRsSCCfwAQuRsIA2wdnGO1XikvkRAnq5b0simdKsUa0vYkPb+yE9GZzCWFVcgHEJ+LcM5Zqjp24exr+Ye5D3zBqHr4PJZlrE4ImOexcF49HMu3x7mBePugjP/5EpYVkRsQFfYR1Zzw+QdkKSbJAk9CXhhoT6BL8fb2lT+jS7QOsyTL2h7Vx6RtfsnITAtRQUiTLBlb9Az9Fcw0wJ0xoywDgPQ8x8isTEXcRmSPlcifnf2h+rz6HBpDE2jChnx//MNKUpc1fkb6sZkJMAPMPWWzRi7dECRitr7520aaiqiA+3WuNA3vCM5JK77KdhDAK37P+bUlAHYEEJs/W7JSaLZsro87Gjz2hNMhC+EmoUj9GuMgVeVTsbRdM7F32wSYZMEAvwRHOht58BQDgzOkOYl5XREOrcixHHL0NMjqvexbDwWKkzdNFgPsk9nwJ1O3TX0SzoZac0kHe+QGIdocFW78DvLEc7kFKReT5cYe9NRZ1Bjq64rHu/pC6ttnw9neqanebNiXn5o/Oj71gE0xeSNsnOiqtgemJr67MFnU9xiAK3MH3WPYyjxSNkc8pNt25VgRQ+dtoWf4RN7gpf2aETuYGLKczH5B3z+A+VJkoINWQXXRppSJtH9VJRVD9A8iZniof0NfTzHf3JRtiEcDviqIr5qq9WX92Gk31rQqOmPo+4lK34cl7cAQ+Rw4iFwH9eXmDpFXBXDdRZ/yYkPI8+ES3Kj/EMhn6UN3JOJGn3pCJ0mh28ikcRAmjYNk0riNVIT2oRzNfJGEqKhedEcaRN7Ni4LgFoQGUjJHyutng04dV2pEE9+duvgOul5FfveDT3dtAb5sZZlI0OPUmFIEnSnFOJku6ZvQ1cgv7FerTp6Lhypn0wML7IXVk2V4OLv6ZJ4sg4hiRvnYC6RvlF6wcOxaJ75VQ48aHnvPd2U06FusTUfUacmO0tD8nFW2qx95MCaalqJ+5HD62De87DMekqh+0atwpvtNFmRFTnuzrosa47zILJdNgToWLO5YpuK7QXQKolncTE9UqWWACEhCFENHH+AVv+eWdXITrRRMdnTgnYobs0LGdiIBQC/By0b2fzKa0atXOYKvaswioiPeh85xk0Qq3f4TM6owNAQARpmlbnhgV7WocQTr/0ufeagf6FnAczGZSGr8KR79KABOAgxu9EIePc3jC6JVeEVSTMuKtCgpy+Qqvy0Ib8tu9jwc/axsZVZ9K89xrfTdeP10MUTfDZClqLstIKEtUgBpg02oxsNVirIXXEQ0pgqrSI0HNAZ3qsprhxRPC8Y7mSV8QbCKr2C237SyFd6KPe+R4C2lVduIih3NLrRQNoEpzWQva7exOt7VXsbKmTkrUSjMJs58HVl7Zdg0NUirOCuY2ticCFSIeXCLl4A9uY6sXnUS6BpYtBB9YdUWx1HtqqJZ7Myt+QbTInwFFinFFdYorv6nLynvu0L9VeZAV/U91bXPzpazyWQwmNyV3LVzB1FpxjaVAeFFA3gBVuhVYyLXVRoTdboBtmUjiwsuOJ+sRwlIyHRS6mgMU0GiCLYe9N6Lr2B7dPZ0tofjReDyJPJrX9MT6cWb0qcau1kJITgL7M0+nr7x5itbKN3V27uXV0TSO3iW5/b29p58tLd3lldASxbxLNxTLIfL+lQnM8rsY27X+tVgM5EDWd1OK13ljURWw2p3JmmNvVayhvsSLSCtsdtyBIOFfFVzy1fZ3M4KTKyoj/XOGLUrgWNlMI+HnRKPlzOgwjWc8MwV2v3nvE0IYe7664nSEBItwp2SxG6QpDt5Cw6JLK+n27jfYQmNI7OU0K74KpyNLmHOLVjEo0dJtW4enzWRz1mRFaoSWVGdRhYRXSS1CqwZqzksIUPfeZZzrOI2dzL7UKBsG+1mlbrGmN8uI7GCOTLC8BIrwZYULLUMCOACFcBlJFxXPTr4OgpUyjJgX4+xeYYxm+ne3GXGA1v+qwoRIyNqTKDVC8YEY59bkZmMU6B6XLdCTqarM7wdosYFntmZ3ZPbx4e3DJbTcWcaPgkL4D/bNQMCkKY0IJ7Pv0dAuJEg6gm1n1y1NkgYUheYp1PDdcB+jlTAeu6vRO9TsBbFivrrT4K88CwRwf6iSB26ZFKChz/KyM2e57xZOfOMpEyieyBNvR3CdeJsfhPQMu0iVa/8rXVooJV10m+bc4dQxDWnMP8GcZxF9QAAeJxjYGRgYADi70uaTOL5bb4ycDO/AIowXHvrORVKT/v/9X8amwdzNJDLwcAEEgUAjhMOO3icY2BkYGAO+p/FwMDm8f/r/69sHgxAERTQCwCaeQbSeJxjfsHAwEwx/v+HWLUsx4BYGcFn84CyN4LN+Qcyi1UXqvby/9/MmTjMWvD/P5gWBLGheCVQbMH/P4ypQDbQXKbZ//8yZUDUM7kA6Rggdga6NfL/X0zzgBhdHGR2JNiun2D6BYTPZI1kJ1jP/68s+hD3gGimU0A1QMz45f8/EA0yB+QmEAbrhZoD0stSBtRThmQnyDwUDHMDkjuhapmaYOZA7GVcgzVu/qOYTUw8gfwtCPQzkM245v9fIP4HdwdQDgAthpiQAAAAAAAAAaQCLgL+A3YD8ARqBMIE9gVgBeIGDAZeBtQHpggUCGAJCglmCbgKGApeCoYK8AuwDE4M6g1ODaYOFA5cDzgPTBBQESQRYBIIE4YT8BQwFOoVPhYwF9wYjBluGc4aBhpYGqwbFhu+HCAcQhyEHLQfQh++IFoghiDmIX4iTiN6I9YkHCROJMgk7CWKJiYmRCauJ7IoZCj+KfQqICuQLEos9C10LngvDC+YL+YwNDCWMSQxzjIGMj4zLDPaNP41ijaKN5Q4CjjwOVo5xDo+OrY7jDv2PKI9Yj3gPhg+UD6yPxQ/7kCYQOZB9kKIQxxDoERmRMRFgkXgRqxHDEguSLJJXEnqShZKuktwS8hMCkyUTOJNME5aTypQNwABAAAAjQECAA8AAAAAAAIARgBWAHMAAAEAC3AAAAAAeJx1kN1KwzAcxU90fm2gouCtuRJF1n2AMAaDwWS70RuR3UpX+zW6ZiSZsNfwHXwYX8Jn8bTNRCa2pPn9z/8kOQ2AM3xBoHruOCoWOGRV8Q4OMHC8S/3ecY384HgPDTw73qf+4riOW8SOGzjHO3cQtSNWc3w4FjgVJ453cCwuHe9SbzqukQeO93AhHh3vUw8c1zEVxnEDV+JzpJZrncaJldejG9ltd3pytpaKUpr7mfRXNlHayKGMVG7DLFNeoBbGNNNA5eYpjFeZrzflZp6G2qQqlx2vvZEmYR5q34avxe7mLe5aG8lIq4Ucu33lUqt5GFgvsXbZb7V+n4cRFJZYQyPlVSWwkLimesO5izY66JFmdEg6K1eKHD4yKj5WXJGUHcN6yBGxyqmGdGRkDwG/C/YNmlwblH2DJzpirs+4i/7T3a6ndBeutKwlc3lMt+2a0JWXTr9M8PqT3eCNp3WpWiYsUuoylcR4K6/kfRS9OZWAulfeiqXaR4vvP//3DQMUgrMAAHicbVQHe9s2EPVzSEqkrdi10zRt070H2yTdM917751CICiiggAGAKUo3Xumv7kH0IqTfuH3UQIPd+/ezbX1tf4p1i79nMM6DiBBigwDDJGjwAY2McJBbGEbl2EHuziEy3EYV+AIrsRVuBpHcQ2uxXW4HjfgRtyEm3ELbsVtuB134E7chbtR4h7ci2M4jhO4D/fjATyIh/AwHsGjeAyP4wk8iZN4Ck/jGTyL5/A8XsCLeAkv4xW8itfwOt7Am3gLb+MdvIv38D4+wIf4CB/jE3yKz/A5vsApfAmGMTgqCNSYoIHEV5hCYQYNgxanYeHg0WGOBc5gibP4Gt/gW3yH7/EDfsRP+Bm/4Ff8ht/xB/7EX/gb/+Ac/l3b1WPFnD+lu9lYWG47zZuhVnJsmV0O9FjqStihbq2Ztd7l2syFnUux2Nizk7o2m3tnb9rjx1YXS9PZgXZLzf18qK1gldSTIxdcMkJiE3o9XRzeu+i/nBVcyLmohnphZZBk2k2lUiu2pzvJp1a4Tnk30tp4WUtOpkZnWmpvTRo9Zto3Uk+ziCIGJAvUBxRSLbXI9MxUQuU6sPGdJdu54Wx8UHeOXCqmJx0RzCl4xr3kIpkJ3RWtYsuSdZU0Sas6l7aWPBaVWeiSiPDmULwrvTjjy0ZOGkWvH/b5FVXBAt1INY1Mk0i0z1Ma6aaR7c6+Ysml5UpUO/uuV6LtFe5KMIp0Vl9HL8VldZk5wSxv1s0040xzoRLnmS3CTymo2svNRqh2pZ1HecNUnduIUkmb84ZZX7ZSFLwRfFoG/ilbMFsloTGSAJA25ManUXXElXFiBTnwTamk8+u+KeZGdTNRmrrO+uPIKbMoQ8RjxqeFma6sih4juBpoZSam87E/a6lEEvTTlnVOJGNDgbVCc6mGitJaUhKSCXEZxloR/SFnSuiKURx7hxOboaTnQ2beCx1LRYDWJZXhLlorw6pcidqXhjwUfULCMa2pP5skqGdkzXizQW2kRBlViv4cDPNYinGnxgmZTIaBfdlW9cheWKI8AJWBUxFPXs6EOyCWYkBvSNZuj7in3nvZuVgWvG1fLOra/+mEmAZW1DRSTU+FQk1jTfP4KdpunPXJzmP6QrCDro3/iTJ8esCzSVYr07bLQSs5zZPYIjh5VpQ06DQ+TNFsVoK5QofSOOqNelMz5+RE02B5t6m1WNSCBVO3pcMO0F4tw8iKaktPhI+7gdrQU+/0m8CNZlLvV2yL05pi9nxgVDHvtmmORHC5kg7DHnBhWRAWwa77ee44q2ujKpeMhVKFn6+UN/rOjgORUS48rcOgUjLlk5CK9a4t+hydoRnq08VpsaTeUiusrf0HmcglTgB4nGPw3sFwIihiIyNjX+QGxp0cDBwMyQUbGVidNjEwMmiBGJu5WBg5ICwBJjCLzWkX0wGgNCeQze60i8EBwmZmcNmowtgRGLHBoSNiI3OKy0Y1EG8XRwMDI4tDR3JIBEhJJBBs5mFh5NHawfi/dQNL70YmBhcADroj/AAA") format("woff"), url("data:application/octet-stream;base64,AAEAAAAPAIAAAwBwR1NVQiCLJXoAAAD8AAAAVE9TLzJWVlMrAAABUAAAAFZjbWFwwNsIqgAAAagAAAlaY3Z0IAze/jEAALi4AAAAKGZwZ22KkZBZAAC44AAAC3BnYXNwAAAAEAAAuLAAAAAIZ2x5Zvh33zIAAAsEAACgbmhlYWQTNtbRAACrdAAAADZoaGVhCZIGNQAAq6wAAAAkaG10ePyE/6UAAKvQAAACNGxvY2GxSttpAACuBAAAARxtYXhwAlYMygAAryAAAAAgbmFtZeZay/oAAK9AAAACzXBvc3SAO3GoAACyEAAABp9wcmVw50MtvgAAxFAAAACGAAEAAAAKADAAPgACREZMVAAObGF0bgAaAAQAAAAAAAAAAQAAAAQAAAAAAAAAAQAAAAFsaWdhAAgAAAABAAAAAQAEAAQAAAABAAgAAQAGAAAAAQAAAAEDmwGQAAUAAAJ6ArwAAACMAnoCvAAAAeAAMQECAAACAAUDAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFBmRWQAQAAy8fgDUv9qAFoDWwCaAAAAAQAAAAAAAAAAAAUAAAADAAAALAAAAAQAAAK6AAEAAAAAAbQAAwABAAAALAADAAoAAAK6AAQBiAAAABgAEAADAAgAMwA5AFToaPCW8LDw8/F28cPxyfH4//8AAAAyADUAQegA8JbwsPDz8XXxw/HJ8fj//wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQAYABoAIgBIARgBGAEYARgBGgEaARoAAAABAAIAAwAEAAUABgAHAAgACQAKAAsADAANAA4ADwAQABEAEgATABQAFQAWABcAGAAZABoAGwAcAB0AHgAfACAAIQAiACMAJAAlACYAJwAoACkAKgArACwALQAuAC8AMAAxADIAMwA0ADUANgA3ADgAOQA6ADsAPAA9AD4APwBAAEEAQgBDAEQARQBGAEcASABJAEoASwBMAE0ATgBPAFAAUQBSAFMAVABVAFYAVwBYAFkAWgBbAFwAXQBeAF8AYABhAGIAYwBkAGUAZgBnAGgAaQBqAGsAbABtAG4AbwBwAHEAcgBzAHQAdQB2AHcAeAB5AHoAewB8AH0AfgB/AIAAgQCCAIMAhACFAIYAhwCIAIkAigCLAIwAAAEGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAECAAMEBQYHAAAAAAAAAAgJCgsMDQ4PEBESExQVFhcYGRobAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAwAAAAABqAAAAAAAAAAjAAAADIAAAAyAAAAAQAAADMAAAAzAAAAAgAAADUAAAA1AAAAAwAAADYAAAA2AAAABAAAADcAAAA3AAAABQAAADgAAAA4AAAABgAAADkAAAA5AAAABwAAAEEAAABBAAAACAAAAEIAAABCAAAACQAAAEMAAABDAAAACgAAAEQAAABEAAAACwAAAEUAAABFAAAADAAAAEYAAABGAAAADQAAAEcAAABHAAAADgAAAEgAAABIAAAADwAAAEkAAABJAAAAEAAAAEoAAABKAAAAEQAAAEsAAABLAAAAEgAAAEwAAABMAAAAEwAAAE0AAABNAAAAFAAAAE4AAABOAAAAFQAAAE8AAABPAAAAFgAAAFAAAABQAAAAFwAAAFEAAABRAAAAGAAAAFIAAABSAAAAGQAAAFMAAABTAAAAGgAAAFQAAABUAAAAGwAA6AAAAOgAAAAAHAAA6AEAAOgBAAAAHQAA6AIAAOgCAAAAHgAA6AMAAOgDAAAAHwAA6AQAAOgEAAAAIAAA6AUAAOgFAAAAIQAA6AYAAOgGAAAAIgAA6AcAAOgHAAAAIwAA6AgAAOgIAAAAJAAA6AkAAOgJAAAAJQAA6AoAAOgKAAAAJgAA6AsAAOgLAAAAJwAA6AwAAOgMAAAAKAAA6A0AAOgNAAAAKQAA6A4AAOgOAAAAKgAA6A8AAOgPAAAAKwAA6BAAAOgQAAAALAAA6BEAAOgRAAAALQAA6BIAAOgSAAAALgAA6BMAAOgTAAAALwAA6BQAAOgUAAAAMAAA6BUAAOgVAAAAMQAA6BYAAOgWAAAAMgAA6BcAAOgXAAAAMwAA6BgAAOgYAAAANAAA6BkAAOgZAAAANQAA6BoAAOgaAAAANgAA6BsAAOgbAAAANwAA6BwAAOgcAAAAOAAA6B0AAOgdAAAAOQAA6B4AAOgeAAAAOgAA6B8AAOgfAAAAOwAA6CAAAOggAAAAPAAA6CEAAOghAAAAPQAA6CIAAOgiAAAAPgAA6CMAAOgjAAAAPwAA6CQAAOgkAAAAQAAA6CUAAOglAAAAQQAA6CYAAOgmAAAAQgAA6CcAAOgnAAAAQwAA6CgAAOgoAAAARAAA6CkAAOgpAAAARQAA6CoAAOgqAAAARgAA6CsAAOgrAAAARwAA6CwAAOgsAAAASAAA6C0AAOgtAAAASQAA6C4AAOguAAAASgAA6C8AAOgvAAAASwAA6DAAAOgwAAAATAAA6DEAAOgxAAAATQAA6DIAAOgyAAAATgAA6DMAAOgzAAAATwAA6DQAAOg0AAAAUAAA6DUAAOg1AAAAUQAA6DYAAOg2AAAAUgAA6DcAAOg3AAAAUwAA6DgAAOg4AAAAVAAA6DkAAOg5AAAAVQAA6DoAAOg6AAAAVgAA6DsAAOg7AAAAVwAA6DwAAOg8AAAAWAAA6D0AAOg9AAAAWQAA6D4AAOg+AAAAWgAA6D8AAOg/AAAAWwAA6EAAAOhAAAAAXAAA6EEAAOhBAAAAXQAA6EIAAOhCAAAAXgAA6EMAAOhDAAAAXwAA6EQAAOhEAAAAYAAA6EUAAOhFAAAAYQAA6EYAAOhGAAAAYgAA6EcAAOhHAAAAYwAA6EgAAOhIAAAAZAAA6EkAAOhJAAAAZQAA6EoAAOhKAAAAZgAA6EsAAOhLAAAAZwAA6EwAAOhMAAAAaAAA6E0AAOhNAAAAaQAA6E4AAOhOAAAAagAA6E8AAOhPAAAAawAA6FAAAOhQAAAAbAAA6FEAAOhRAAAAbQAA6FIAAOhSAAAAbgAA6FMAAOhTAAAAbwAA6FQAAOhUAAAAcAAA6FUAAOhVAAAAcQAA6FYAAOhWAAAAcgAA6FcAAOhXAAAAcwAA6FgAAOhYAAAAdAAA6FkAAOhZAAAAdQAA6FoAAOhaAAAAdgAA6FsAAOhbAAAAdwAA6FwAAOhcAAAAeAAA6F0AAOhdAAAAeQAA6F4AAOheAAAAegAA6F8AAOhfAAAAewAA6GAAAOhgAAAAfAAA6GEAAOhhAAAAfQAA6GIAAOhiAAAAfgAA6GMAAOhjAAAAfwAA6GQAAOhkAAAAgAAA6GUAAOhlAAAAgQAA6GYAAOhmAAAAggAA6GcAAOhnAAAAgwAA6GgAAOhoAAAAhAAA8JYAAPCWAAAAhQAA8LAAAPCwAAAAhgAA8PMAAPDzAAAAhwAA8XUAAPF1AAAAiAAA8XYAAPF2AAAAiQAA8cMAAPHDAAAAigAA8ckAAPHJAAAAiwAA8fgAAPH4AAAAjAAAAA0AAP96A5MDQgAPAB8AMQBBAFEAYQBxAIEAkQChALEAwQDRATlLsBlQWEB6ABMADQMTZQANBwMNYwAHAwMHYwAKBBAECmUAEBYEEGMAFhkEFmMaARgAAQAYAWAAAAADAgADYAASABUPEhVgAAwADwkMD2AABgAJBQYJYAACAAUIAgVgABQAFxEUF2AADgARCw4RYAAIAAsECAtgAAQEGVgAGRkPGUkbQH8AEwANAxNlAA0HAw1jAAcDAwdjAAoEEAQKZQAQFgQQYwAWGQQWYxoBGAABABgBYAAAAAMCAANgABIAFQ8SFWAADAAPCQwPYAAGAAkFBglgAAIABQgCBWAAFAAXERQXYAAOABELDhFgAAgACwQIC2AABAoZBFQABAQZWAAZBBlMWUAyxMLMycLRxNG/vLe0r6ynpJ+cl5SPjIeEf3x3dG9sZ2RfXFdUT0w1NTU1NzU1NTIbBR0rARQGIyEiJj0BNDYzITIWFREUBisBIiY9ATQ2OwEyFh0DFAYrASImPQE0NjsBMhYVJxQGKwEiJj0BNDY7ATIWHQEUBisBIiY9ATQ2OwEyFh0BFAYrASImPQE0NjsBMhYVAxQGKwEiJj0BNDY7ATIWHQEUBisBIiY9ATQ2OwEyFh0BFAYrASImPQE0NjsBMhYVAxQGKwEiJj0BNDY7ATIWHQEUBisBIiY9ATQ2OwEyFh0BFAYrASImPQE0NjsBMhYVASEiBhURFBYzITI2NRE0JgMrFA791g4UFA4CKg4UFA4jDhQUDiMOFBQOIw4UFA4jDhStFA4jDhQUDiMOFBQOIw4UFA4jDhQUDiMOFBQOIw4UrRQOIw4UFA4jDhQUDiMOFBQOIw4UFA4jDhQUDiMOFK0UDiMOFBQOIw4UFA4jDhQUDiMOFBQOIw4UFA4jDhQCKv1MHCkpHAK0HSgoAgsOFRUOrQ4VFQ7+pg4VFQ4jDhQUDr8RrQ4VFQ7QDhQUDooOFRUOIw4UFA7QDhUVDiMOFBQO0A4VFQ4jDhQUDgE3DhUVDiMOFBQO0A4VFQ4jDhQUDtAOFRUOIw4UFA4BNw4VFQ4jDhQUDtAOFRUOIw4UFA7QDhUVDiMOFBQOAxsoHfzCHCkpHAM+HSgAAAQAAP9qA+gDUwAPAB8ALwBEAD5AOyggGBAEAAEBRwADBAEBA2UAAgAFAAJlAAEBBFkABAQOSAAAAAVYAAUFDwVJQD82NSwqJCIdGhUSBgUUKyUWBg8BBiYnAyY2PwE2FhcDFAYrASImNRE0NjsBMhYVAxQGKwEiJjURNDY7ATIWFQE0JyYnJiAHBgcGEBcWFxYgNzY3NgMoAgkIRQgPAnUCCQhFCA8ChwwJRgkMDAlGCQyZDAlwCA0MCXAIDQJVRENxdP7wdHFDRERDcXQBEHRxQ0RtCA8CDwIJCAIJCA8CDwIJCP3kCA0NCAIWCA0NCP3qCA0NCAIWCA0NCP7uiHRxQ0REQ3F0/vB0cUNERENxdAAAAAIAAP9qA+gDUwAUAGoAV0BUMzICBQMBRwAHAAMABwNtAAUDBgMFBm0ABgQDBgRrAAQCAwQCawACAQMCAWsAAwMAWAgBAAAOSAABAQ8BSQEAZGNNTEdGPTwvLSAdCwoAFAEUCQUUKwEiBwYHBhAXFhcWIDc2NzYQJyYnJhMBBgcGDwEjBiMxIiYnMSYnJjU0NjcBNjczMhczFwcWBwEOARYXHgEyNj8BATY0LwEmIg8BDgEWMj8BNhc3FxYUDwEGBwYmLwEmND8BPgEyFh8BHgEGAfSIdHFDRERDcXQBEHRxQ0REQ3F0n/7FEgseKAUIDAclQxskDQUcGgEfBQoCCQUBEAgGCv7hGhIRGhQxNjATBwE1GxoBGVAa/w4BHysO4wgOAQ0HB+MNEhk7FggdHf8UNTk1FAIaEhMDUkRDcXT+8HRxQ0REQ3F0ARB0cUNE/kr+xRAHFAgBAhwaJDUXFCVEGgEfBQIECwIPCv7hGkZGGhMUExMGATYbTBsBGxv+DysdDuMIAgcNBxUH4w0IDAgTBx5SHv8UFhYUAxxJSAAAAwAA/68DxAMNABYAJgA+ACdAJAoHAgMAAgFHPC4pAwFFAAECAW8AAgACbwAAAGYsKxsZFAMFFSslMScFBiInJQcGFRQWFxUFFjI3FSU2NAExBRc3JTY0JyUmIgcFBhQFMScFBiInJQcxDgEVFBcFFjI3JTY1NCYDuqf+9QoUCv71pwoGBAG/BAYEAb8K/GoBvwcHAb8KCv5BBAYE/kEKA5an/vUIGAj+9acEBgoBvwIKAgG/CgWWSnYFBXZKBQoFCAIBxgICAccFFQGVxwEBxwUVBcYCAsYFFb5LdwQEd0sBCQUKBccBAccFCgUJAAAAAQAA/64DdQMRACIAeUAMGgkCBAAZDAIDAgJHS7AVUFhAGAAEAAMBBANgAAICAFgAAAAMSAABAQ0BSRtLsChQWEAYAAEDAXAABAADAQQDYAACAgBYAAAADAJJG0AdAAEDAXAABAIDBFQAAAACAwACYAAEBANYAAMEA0xZWbcZFSIVFAUFGSsBJicmBwYHBg8BETMRNjc2FxYXFjc2NzY/AREHBgcGBwYnJgH0OD00NSsqHhsVHkVKcGQ8PzQ1KygdGhMTGh0oKzU0PwLiHAoJBQMMCQsK/M8BcRsFBjIeDAkEAwwIDAoBzgoMCAwDBAoMAAAAAAMAAP9qA+gDUwAUAB0AOQA8QDk5JiADBAUBRwADAAUEAwVeAAICAFgGAQAADkgABAQBWAABAQ8BSQEAMC8fHhsaFxYLCgAUARQHBRQrASIHBgcGEBcWFxYgNzY3NhAnJicmAzYyFhQGIiY0EyM1PwE+AT0BNCcuAS8BJiM1NxcVFB4BHwEWMwH0iHRxQ0REQ3F0ARB0cUNERENxdLIQLCAgLCCTqw4LCgYEBA0JAwsEhQQJDQYEBgMDUkRDcXT+8HRxQ0REQ3F0ARB0cUNE/uQQIioiIir+UhYBAwULDK8ICggJAwEDFggE7woPBwEBAgAAAAADAAD/agN4A1IAGwAmADIACrcsJyMfDgADLSslNxc/Ayc3JzcvAwcnDwMXBxcHHwMWHwE/ARcDDwIlBgc3HwE3NjcHLwEBqUtLOE8bQggpKQhCG084S0s4TxtCCCkpCEIbT48nQxBQF5d4EV1E/poyRpcXUBBDJ05DXsIaGjgJSypPQ0ROK0oKNxkZNwpKK05EQ08rSgpeYagohgkqAS0tDEJ7fq8qCYYoqGEaQgwAAAEAAP93A9wDRQAXAAazFgoBLSsFEwc3JTcnBScXExc3AzcHBQcXJRcnAycBPSTwo/759NYBBm3QGmOaJfGiAQf11v76bdAaY2sBBm3QGmOaJPCiAQb01v77bNAaY5ol8aL++vUAAAAAAwAA/2oD6ANTABQAHAAjAFtAWCEBAwQBRwAIAAcACAdtAAcFBQdjAAIFBAUCBG0ABAMFBANrAAMGBgNjAAUFAFkJAQAADkgABgYBWQABAQ8BSQEAIyIgHx4dHBsaGRgXFhULCgAUARQKBRQrASIHBgcGEBcWFxYgNzY3NhAnJicmAyMVIzUjNTMTIwMzFzczAfSIdHFDRERDcXQBEHRxQ0REQ3F0tlA7UNvpSmpDTExDA1JEQ3F0/vB0cUNERENxdAEQdHFDRP5l3980/u0BE9TUAAAEAAD/agPoA1MAFAAgACwAOABNQEoABQoBBAYFBGELAQYABwIGB2AJAQIAAwACA2AAAQEOSAgBAAAPAEkvLSMhFxUBADUyLTgvOCkmISwjLB0aFSAXIAsKABQBFAwFFCsFMjc2NzYQJyYnJiAHBgcGEBcWFxYBISIGFBYzITI2NCYlITI2NCYjISIGFBYFISIGFBYzITI2NCYB9Ih0cUNERENxdP7wdHFDRERDcXQBev4cFh8fFgHkFh8f/gYB5BYfHxb+HBYfHwH6/hwWHx8WAeQWHx+WRENxdAEQdHFDRERDcXT+8HRxQ0QBdh8sHh4sH/wfLB8fLB9JHywfHywfAAAAAAEAAP+zA8ADCQAJAB1AGgIBAEUJCAcGBQUBRAAAAQBvAAEBZhIQAgUWKwEhCwEhBQMlBQMDwP6hbW3+oQEcZwEXARdmAcEBSP64yv68vb0BRAAAAAEAAP/FA74C+AAhADW0FAMCAURLsBxQWEAMAgEAAAxIAAEBDAFJG0AKAgEAAQBvAAEBZllACwEABwUAIQEhAwUUKwEiBgcuASMiDgEVFBcWFxYXFhcWFzY3Njc2NzY3NjU0LgECuTpmJSVlOkd5RjwvWjVmKxIdEBAdEitmNVovPEZ4AvcvKiovRnlHZ2FOTi1JHw0WEBAWDR9JLU5OYWdHeUYABAAA/2oD6ANTABQAHQArADUAPUA6MjErKgQCARkBAwIWFQIAAwNHAAIBAwECA20AAwMBWAABAQ5IBAEAAA8ASQEAHRsYFwsKABQBFAUFFCsFMjc2NzYQJyYnJiAHBgcGEBcWFxYTBzczFRQWOwEnMQ8BFRQWOwE3NjcBJwUnJiIPARc3NjQB9Ih0cUNERENxdP7wdHFDRERDcXQZridFBwQ3mAMsBwQCyAQBATSrAQabAwoDS6tLA5ZEQ3F0ARB0cUNERENxdP7wdHFDRAEKJ643BAdVBcgCBAcsAgEBNKtAmwMDS6tLAwoAAAADAAD/agPoA1MAFABqAHMARkBDOC8iGQQFAmgBBAVhWE1DBAMEA0cABQYBBAMFBGAAAgIBWAABAQ5IAAMDAFgAAAAPAElsa3Bva3Nsc1RRKScZFQcFFisBFAcGBwYgJyYnJhA3Njc2IBcWFxYHMScmJzc2Ji8BJgc1ByYvAS4BKwEiBg8BBgcnJgYPAQ4BHwEGDwEGHQEUHwEWFwcGFh8BHgE3FTcWHwEWOwEyPwE2NxcWNj8BPgEvATY/AT4BPQE0JgUiJjQ2MhYUBgPoRENxdP7wdHFDRERDcXQBEHRxQ0SuVgcNLAIBAzMGCE4YFxkBBgRIBAYBGRYXTwMIAzUDAQIrCwZXCAhXBgsrAgEDNQMIA08WFRkDCUoJAxkTGk4DCAMzAwECLAsJVgQEBP62KDg4UDg4AV6IdHFDRERDcXQBEHRxQ0REQ3F0WRkXGE4DCAMzBgUBLA0HVgQEBARWBwsrAgEDNQMIA1AVFRkDCUoJAxkVFVADCAM1AgECASsLB1YICFYGDSsCAQMzAwgDThIdGQEGBEgEBo44UDg4UDgAAAACAAD/oAOzAxwAEQAZAH5LsBVQWEAeAAAEAwQAA20AAwMEWAUBBAQQSAACAgFZAAEBEQFJG0uwKFBYQBsAAAQDBAADbQACAAECAV0AAwMEWAUBBAQQA0kbQCEAAAQDBAADbQUBBAADAgQDXgACAQECUgACAgFZAAECAU1ZWUANEhISGRIZEhUZEAYFGCsBIgcGBwYUFxYXFjI3Njc2NSETESE0JyYnJgHJbl5bNjc3Nlte3F5bNTf+bVYBlDc1XF4CyDc2W17cXls2Nzc2W15uAej+bG5eWzY3AAAAAwAA/2oD6ANSABAAEwAWADRAChYVExIQBQEAAUdLsDJQWEALAAAADkgAAQEPAUkbQAsAAAEAbwABAQ8BSVm0FyICBRYrATQmIwcBBhQXBRMWMzI2NwkDEwMBA+gKCAf8PAsLAYKeBgoFCgIBm/xZA0j+D6WMAfIDQAgKAf5lBRYGnv5+CwYFA8T+bQFm/g7+kAFWAfIAAAAE//z/ZgPsA1YAEwAnADsATwBNQAoIAQEAMAECAwJHS7AqUFhAFQABAQBYAAAADkgAAwMCWAACAg8CSRtAEwAAAAEDAAFgAAMDAlgAAgIPAklZQAtFRD49HRwWFQQFFCsTLgE+Ah4BFx4BFxYHBiYnJicmAT4BHgIOAQcOAQcGJyY2NzY3NgEeAQ4CLgEnLgEnJjc2FhcWFxYBDgEuAj4BNz4BNzYXFgYHBgcGIRsHLVNlXTgEAykuGhsYd0RJOUECgyhkXDkILlQzUXU6IQwMEhkbJioBMxsHLVNlXTgEAyktGhsYdkRJOUH9fShkXDkILlUyUXU6IQwMEhkbJioCLSljXDkILlQyUnU6IA0LERkcJSoBMxsHLVNlXTgEAiouGhsYd0RJOUH9fShkXDkILlQzUnU5IQwMEhkbJir+zRsHLVRkXTgEAiouGhsYd0RJOUEAAwAA//8DpQK9AAsAFwAjAEJAPwADBwECBAMCYAgBBAAFAAQFYAYBAAEBAFQGAQAAAVgAAQABTBoYDgwCACAdGCMaIxQRDBcOFwgFAAsCCwkFFCslISIGFBYzITI2NCYBITI2NCYjISIGFBYFISIGFBYzITI2NCYDWP04IC0tIALIIC0t/RgCyCAtLSD9OCAtLQLo/TggLS0gAsggLS2fL0IvL0IvAX4vQi8vQi9vL0IvL0IvAAAAAAEAAAAAA+gCnwAcAEW1CQECAQFHS7AJUFhAFgAAAQEAYwABAgIBVAABAQJZAAIBAk0bQBUAAAEAbwABAgIBVAABAQJZAAIBAk1ZtTgjJQMFFysBNjU0LgEjIgYHJiMiBgcOARUUHgEzITI+ATQuAQNEA0NzRFGAGiIrM0oIP1E1WjUCcTFSMCtMAYESE0RyQ11KGUIxEWlDNlo0MFJeTzEAAAAAAwAA/68DowMNAAgAGQAjAEhAEiAfGRgEAAIEAQEAAkcBAAIBREuwKFBYQBIAAAIBAgABbQABAW4AAgIMAkkbQA4AAgACbwAAAQBvAAEBZlm2HRwjEgMFFislBzczFRQWOwEnMQcGBzEDFBYzNxUlNjcBJwUnJiIPARc3NjQBWvE1YAkGTdMBAgE+CQcDARUEBAGr7QFr1wUMBWjtaAUINfFNBgl2AgMC/ugHCQEBPgEDAaztWdcFBWjtaAUMAAAAAQAA/9ADoQLsABYAOLUPAQABAUdLsBVQWEAQAAIBAm8AAQABbwAAAA0ASRtADgACAQJvAAEAAW8AAABmWbUUFxQDBRcrCQExDgEiJicDJjU0NjIfAQE2MhYVFAcDkf4WCyAlIQrXDi1AFpYBvBdBLRACcf19DhARDwEzExkgLBaWAeQZLR8aFQAAAAABAAD/swPAAwkACQAcQBkHAQBFBAMCAQQBRAAAAQBvAAEBZhIVAgUWKyUTJQUTJSEbASECpWb+6f7pZ/7kAV9tbQFf9/68vb0BRMoBSP64AAIAAP/nA9sC1QAIAC8AQ0BALwEFAAFHAAIBBwECB20ABwABBwBrAAMABgEDBmAAAQAABQEAYAAFBAQFVAAFBQRYAAQFBEwVFSMpFxITEggFHCsBFBYyNjQuAQYFIzY1NCcmJyYiBwYHBhQXFhcWMzI2NCYjIi4BND4BMh4BFRQHIxcBqSUzJSUzJQIyfgEzMlVXzFdVMjMzMlVXZholJRpEc0NDc4hzQwJ7vAFeGSUkNCQBJTkKFWZXVTIzMzJVV8xXVTIzJTQkQ3OIc0NDc0QLFLwAAgAA/9QDzALoADIAZgA2tkgUAgEAAUdLsBVQWEALAAAAAVgAAQENAUkbQBAAAAEBAFQAAAABWAABAAFMWbVBQBwCBRUrAQYHBiYvASYnLgEnJgYHBgcGBwYHBjA3Njc2NzYXFhcWFxYfARYGDwEGFhcFFjY3EzYmATY3PgEXFhcWFx4BFxY2NzY3Njc2NzYwBwYHBgcGJyYnJicmLwEmNj8BNiYnJSYGBwMGFgOwJSUJEgQHCQQkbkBDgT43LioaKRACAyIyMEVLQUAzLBICBAECBQdBDgEQAQgQHAVLBA38exAPIRMKBwUMCCRuP0OBPjcuKhopEAIDIjIwRUtBQDMsEgIEAQEEB0IOAhD++BAbBUwEDgJQFBUFBwYKCwUtShMVBhgVJSEmOUIGBTonKBISEg8uKC8FCgQFEAQkCBIESwQPDwEIEAv+FAkJEwkEAwYSCC1KExUGGBUlISY5QgYFOicoERMTDy0oLwUKBAYPBCQIEgRMBBAP/vgQCwAABQAA/9AD2ALsAAsAEAAcACkAMAChtS4BBwgBR0uwFVBYQDQAAgMFAwIFbQAJBQgICWUAAQoBAAQBAGAABAsBAwIEA2AABQAIBwUIXgAHBwZZAAYGDQZJG0A5AAIDBQMCBW0ACQUICAllAAEKAQAEAQBgAAQLAQMCBANgAAUACAcFCF4ABwYGB1IABwcGWQAGBwZNWUAfEhEBADAvLSwrKickHx0YFhEcEhwQDwcFAAsBCwwFFCsTITI2NCYjISIGFBYBETQmIyUhMjY0JiMhIgYUFgUhIgYVERQWMyEyNjUlIwMzFzczvQJuCAoLB/2SBwsLAyIUDvzBAvoHCgoH/QYHCgoDRvx8DhQUDgOEDhT+UGh5Xk9PXgLJCw4KCg4L/SoCTA4UIwoOCwsOCiMUDv20DxQUD34BQejoAAYAAAAAA6oCtgALABQAHQApADIAPgB1QHIQAQgACQAICWAAAQwBAAIBAGAPAQYABwMGB2ANAQIAAwQCA2AOAQQKBQRUEQEKAAsFCgtgDgEEBAVYAAUEBUw1MysqIB4WFQ0MAgA7ODM+NT4vLioyKzImIx4pICkaGRUdFh0REAwUDRQIBQALAgsSBRQrASEyNjQmIyEiBhQWByIGFBYyNjQmAyIGFBYyNjQmASEiBhQWMyEyNjQmASIGFBYyNjQmASEiBhQWMyEyNjQmAWcB9CEuLiH+DCAuLrogLi5ALi4gIC4uQC4uAq7+DCAuLiAB9CEuLv0RIC4uQC4uAq7+DCAuLiAB9CEuLgIZL0AuLkAvbS5ALi5ALv73L0AuLkAvAQkuQC4uQC4BCi5ALy9ALv3tL0AuLkAvAAEAAP+UA1sDJwAaAGq1AAECAAFHS7AVUFhAGgAAAQIBAAJtAAIDAQIDawABARBIAAMDEQNJG0uwKFBYQBkAAAECAQACbQACAwECA2sAAwNuAAEBEAFJG0ATAAEAAW8AAAIAbwACAwJvAAMDZllZthUmFCIEBRgrATQmIyETNjQmIgcBFQYUFjMhAxUGFBYyNwE2A1sJB/6ymQEJDgX+FgQJBwFOmQEJDQYB6gQBsAcJAVEBDAkF/fYBAw8J/rABAQwKBgILBAAAAwAA/2oExgNSAA8AHwAvAClAJgADAAIFAwJgAAAAAVgAAQEOSAAFBQRYAAQEDwRJNTU1NTUyBgUaKxEUFjMhMjY9ATQmIyEiBhURFBYzITI2PQE0JiMhIgYVERQWMyEyNj0BNCYjISIGFRELBI4MEBAM+3ILERELBI4MEBAM+3ILERELBI4MEBAM+3ILEQKQDBAQDKYMEBAM/dUMEBAMpgwQEAz91QwQEAymDBAQDAADAAD/agQjA1IADwAhADkAJkAjEQECAEUaGQkIBAFEAAABAQBUAAAAAVgAAQABTDAtKCUCBRQrAQcWFxYUBwYHFzY3NhAnJgUHFhcWFRQHBgcXNjc2NTQnJiUFDgErASIGHQEUFjsBMhYXBRY2NRE0JgNsVEwpKikoSlNWLjAxL/8AVTceHhwbM1M+ISMkI/7//vwIHAu2CxAQC7oKGwkBAggLDANSQFtuc/JwbVtCaX2CARaDfhdAQE5RV1NOSkBCTVtfZmlhXnXvBwsPC9ALDwsH7wgFCwL1CgYAAQAA/2oD6ANSACMAJ0AkAAMAAgADAmAABQAAAQUAYAAEBA5IAAEBDwFJIzMlIzMjBgUaKwEVFAYjIREUBisBIiY1ESEiJj0BNDYzIRE0NjsBMhYVESEyFgPoFA3+qhMNuQ0U/qgMExINAVgUDbkNEwFWDhMBvLkNFf6rDRUVDQFVFQ25DRIBWA0SEg3+qBIABAAA/2oD6ANSAC8AOABIAFgAsbYtDQIHAgFHS7AVUFhAPAACAAcKAgdgAAEABAgBBGAOAQoKC1gACwsOSAwBAAAFWAAFBQ1IDQEGBgNYAAMDDUgACAgJWAAJCQ8JSRtAOAACAAcKAgdgAAEABAgBBGAMAQAABQMABWANAQYAAwkGA2AOAQoKC1gACwsOSAAICAlYAAkJDwlJWUAnSkkxMAEAU1BJWEpYRkM+OzU0MDgxOConIh8aFxIPCQcALwEvDwUUKwEjIgYdARQGIyEiJj0BNCYrASIGFREUFjsBMjY/AT4BMyEyFh8BHgE7ATI2NRE0JgUiJjQ2MhYUBgEuASMhIgYPAQYWMyEyNicBITI2JwMuASMhIgYHAwYWA9N9CA0MCP2NCAsOCHwJDAwJmgkPAhACDwkCAgkPAhACDwmaCQwM/HcRGBgiGRkCegIPCf5gCQ8CIAIKCAH0CQkC/ecCHggMAU8BDgj+iQkNAk4BCwIuDAh9CQwMCX0IDAwI/bkJDQwJVAgMDAhUCQwNCQJHCAx+GSIZGSIZ/kwJDAwJfggMDAgCNgwJAXQJDAwJ/owJDAAAAAABAAD/agZIA1IAAgANQAoAAAAOAEkRAQUVKwUBIQMk/NwGSJYD6AAABQAA/2oD6ANSAA8ANAA3AE8AZwDTQA83AQgJJAECAwJHMwEFAUZLsAlQWEBJAAgJBAkIBG0ABAUCBGMABQMJBQNrAAMCCQMCawAGAgoCBmUACQAKDAkKYAALAAwBCwxgAAcHAFgNAQAADkgAAgIBWQABAQ8BSRtASgAICQQJCARtAAQFCQQFawAFAwkFA2sAAwIJAwJrAAYCCgIGZQAJAAoMCQpgAAsADAELDGAABwcAWA0BAAAOSAACAgFZAAEBDwFJWUAhAgBiYVJRSkk6OTY1LCsjIiAfGxoUEhEQCgcADwIPDgUUKwEhIgYVERQWMyEyNjURNCYDIzUzMjc+AScmJyMHBhcWOwEVIzU3Mj4BPwETMxMXHgEfATMXJTMnJSYiDwEGFBceARQGBwYUHwEWMjc+ATQmNyYiDwEGFBceARQGBwYUHwEWMjc+ATQmAhT+QCMxMSMBwCMyMjCfBwsHBAECBxKDGwUFCBsHjQQCFAsGBYwqiAUGEQoCBgH+9F4sAboEDwUeBQUgIyMgBQUeBQ8EKy4uTAQPBR4FBTg9PDkFBR4FDgVDR0cDUjMk/MYkMzMkAzokM/0/JgoFEAgRNEoMCQ0mJAILDAoJAXH+kgoMEwMBB7KDYQYFHwcMBSVdYlwlBwwFHwUGL3mAeasGBR8HDAU+nKibPgUOBR8FBUm3yLgAAAQAAP9qA7EDUgAMABIAIgAzARNAJRQBCAcxAQ0MAkcVAQccAQsdAQoyAQAwAQ0vAQ4uAQ8HRgIBEERLsBVQWEBdAAQCBQIEBW0ABQMCBQNrAAARAREAAW0AAQwRAQxrABAPEHAAAwAGBwMGXwAHAAgLBwheEgELAAoJCwpeAAkTAREACRFeAAwADQ4MDV4AAgIOSAAODg9WAA8PDQ9JG0BbAAQCBQIEBW0ABQMCBQNrAAARAREAAW0AAQwRAQxrABAPEHAAAwAGBwMGXwAHAAgLBwheEgELAAoJCwpeAAkTAREACRFeAAwADQ4MDV4ADgAPEA4PXgACAg4CSVlAJiMjExMjMyMzLSwrKikoJyYlJBMiEyIhIB8eEREUERETMxIQFAUdKyUzCQEzETQ2OwEyFhUFMzUjFTMTNzUnIxUzFScHFRczNSM1BxUzFSMVMxUjFTM3NSc3NScBlbT+3P7btBoThxMaAXU4bzdvOC/o36k1ON7eON6mpt7eODg4LYv+3wEhApsSGhoS6t43/ns4Nzg4OAE4ODc3OKc3ODg3ODg3OBYtLAAD//7/aAPoA1IADQARABcAF0AUFxYREA8IBwcARAAAAA4ASRIBBRUrAScmIg8DFz8CNjQBFwEnAQYWNyUnA99/CRkIFioVqRYqFQn8r6oCFqr9VAMICAEAqgLKfwkJFSoWqRUqFggZ/eqqAhaq/LcICANjqgAAAAAE//z/ZgPsA1YAEwAnADsATwBItTABAgMBR0uwKlBYQBUAAQEAWAAAAA5IAAMDAlgAAgIPAkkbQBMAAAABAwABYAADAwJYAAICDwJJWUALRUM+PR0cFhUEBRQrEy4BPgIeARceARcWBwYmJyYnJgE+AR4CDgEHDgEHBicmNjc2NzYBHgEOAi4BJy4BJyY3NhYXFhcWAQ4BLgI+ATc+ATc2FxYGBwYHBiEbBy1UZF44AwMpLhobGHdESTlBAoMoZFw5CC5UM1F0OyANCxEZHCUqATMbBy1TZV04BAMpLRobGHZESTlB/X0oZFw5CC5VMlJ0OiEMDBIZGyYqAi0pY1w5CC5VMVJ1OiANCxEZHCUqATMbBy1TZV04BAIpLhobGHZESTlB/X0oZFw5CC5UM1F1OiEMDBIZGyYq/s0bBy1UZF44AwMpLhobGHdESTlBAAALAAD/ZgUtA1sAJAA0AEQAVABkAHQAhQCWAKcAuADIAJRAkSIEAhJFABIDEm8AAwQDbwAKCRQJChRtABQACRQAawARABABERBgAAQAAQIEAWAADwAMBQ8MYAACAAUGAgVgAAsADgcLDmAABgAHCAYHYAANABMJDRNgAAgACQoICWAAAAAPAEnDwru6tbStrKSjnJuTkouKgoF6eW9uZ2ZfXldWT05HRj8+NzYvLicmFhQVBRQrAS4BBgcuAQYHBhURFBY3PgEWFxY7ATI3PgEWFxYzMjc2NRE0JgE2MhceAQ4BJyYiBwYuATY3NjIXHgEOAScmIgcGLgE2EzYyFx4BDgEnJiIHBi4BNhc2MhceAQ4BJyYiBwYuATYXNjIXHgEOAScmIgcGLgE2Jw4BJyYiBwYuATY3NjIXHgEHDgEnJiIHBi4BNjc2MhceAQMOAScmIgcGLgE2NzYyFx4BJw4BJyYiBwYuATY3NjIXHgEBNjIXHgEOAScmIgcGLgE2BSJk4uJkZOLiYwsSC1/Y2F8GAwIIA1/Z2F8GAwYECgb9yHHycQsKBxULaOBpCxUHCwtx8nELCgcVC2jgaQsVBwsLcfJxCwoHFQto4GkLFQcLC3HycQsKBxULaOBpCxUHCwtx8nELCgcVC2jgaQsVBwuUBBQLaeBpCxQICwtx8nELCwQEFAtp4GkLFAgLC3HycQsLBAQVCmngaQoVCAsLcfJxCwsEBBUKaeBpChUICwtx8nELC/4WcfJxCwsIFAtp4GkLFAgLAwgxIR8wMB8hMQUN/IgKDQUvHx8vAgIvHx8vAgMHCgN4Bgr+/SYmAxUWCgQiIgQKFhWRJSUEFBYLBCMjBAsWFP7pJSUEFRULBCIiBAsWFIolJQQUFgsEIyMECxYUiiUlAxUVCwMjIwMLFRX8CwsEIiIECxYUBCUlBBSZCwsEIyMECxYUBCUlBBQBEAsKBCIiBAoWFQMmJgMVgwsLBCMjBAsWFAQlJQQU/eElJQMVFQsDIyMDCxUVAAMAAP9qA+gDUwAUABwAIwBbQFghAQMEAUcACAAHAAgHbQAHBQUHYwACBQQFAgRtAAQDBQQDawADBgYDYwAFBQBZCQEAAA5IAAYGAVkAAQEPAUkBACMiIB8eHRwbGhkYFxYVCwoAFAEUCgUUKwEiBwYHBhAXFhcWIDc2NzYQJyYnJgMjFSM1IzUzEyMDMxc3MwH0iHRxQ0REQ3F0ARB0cUNERENxdLZQO1Db6UpqQ0xMQwNSRENxdP7wdHFDRERDcXQBEHRxQ0T+Zd/fNP7tARPT0wAAAf/7AAAE0wNaACMABrMbCQEtKwE0JyYnJicuAgYHJgcGBw4BFhcWFxYXFjceATc+ATc2Nz4BBNMBBTonOCyVu7JBc2paPS0pCyAZKkJcdpk+kEc6ZyhiOyAiAbENBVlBLBxHWRQ0ORsgHD0scns4LCU5GB8cLCUJBzYqET4jVwAHAAD/agNpA1IADQAUACAALAA4AEQAUACEQIEFAQMCFAEBAwJHAAIEAwQCZRIBCwAKCQsKYBEBCQAIBwkIYBABBwAGBQcGYA8BBQAEAgUEYAAMDABYDQEAAA5IDgEDAwFYAAEBDwFJR0U7OS8tIyEXFQIATUpFUEdQQT45RDtENTItOC84KSYhLCMsHRoVIBcgEQ8IBgANAg0TBRQrASEiBhURFyEyNjURNCYBJzMyFh0BJSEiJjQ2MyEyFhQGJyEiJjQ2MyEyFhQGJyEiJjQ2MyEyFhQGJyEiJjQ2MyEyFhQGJyEiJjQ2MyEyFhQGAz787RIZ4wJbEhkZ/aLSpRMbAeL+pwwQEAwBWQsQEAv9vAwQEQsCRAsQEAv9vAwQEQsCRAsQEAv9vAwQEAwCRAsQEAv9vAwQEQsCRAsQEANSGRL9JuMZEgOSEhn8LtMbE6WtEBYQEBYQlRAWEBAWEJUQFxAQFxCVERYQEBYRlhAWEBAWEAAEAAD/bAPmA1EADwASABYAGgBAQA0aGRgWFRQSEQgBAAFHS7AyUFhADAIBAAAOSAABAQ8BSRtADAIBAAABWAABAQ8BSVlACwIACgcADwIPAwUUKwEhIgYVERQWMyEyNjURLgEBNxc3JwEXNyc3FwN6/PEtPj4tAw8uPgE9/RNASyFKAVdKIktLSgNRPS388C0+Pi0DEC09/NWESyJKAVdKJEpLSwAAAAAEAAD/agPoA1IAEwArAEEAVwDaS7ASUFhANwAGBAUEBmUABQIEBQJrAAIHBAIHawAHCAMHYwAIAwMIYwAEBAFYAAEBDkgAAwMAWQkBAAAPAEkbS7ArUFhAOQAGBAUEBgVtAAUCBAUCawACBwQCB2sABwgEBwhrAAgDAwhjAAQEAVgAAQEOSAADAwBZCQEAAA8ASRtAOgAGBAUEBgVtAAUCBAUCawACBwQCB2sABwgEBwhrAAgDBAgDawAEBAFYAAEBDkgAAwMAWQkBAAAPAElZWUAZAgBRUDs6Li0qJyQjHh0aFwwJABMCEwoFFCsFISIuATURND4BMyEyHgEVERQOAQEVFBY7ATIfARY+ATURNC4BDwEGKwEiBiUmDgEWFx4BBwYPAQ4BFjI3PgE1NCY3Jg4BFhceARUUBgcGHgEyNz4BNTQmA3387h0xHR0xHQMSHTEdHTH89BALWgsHqwgVDw8VCKsHC1oLEAHOCRcQAgkqJwkKKAYLAhEYByYqMkAJFxACCSwxKSYIARAYBy4xO5YdMR0DEh0xHR0xHfzuHTEdAjGgCxAHmggBDwsB8QsPAQiaBw9sBwERGAclajg7MgUHGxEJJmQ2OmxPCAIRGAcnazs2YyYIGBAJLndBR4EAAAAABAAA/2oD6QNSAA8ANgCVAOABNUArHxgCBAMvEAIFAsvEAhMS4MMCERO0pAIPDoh/dQMMCzw6AgkKY1QCCAcIR0uwKlBYQGQABAMCAwQCbQACBQMCBWsAExIREhNlAAUAFBIFFGAAEgARDhIRYAAOAA8QDg9eABAADQsQDWAACwAKCQsKYAAMAAcIDAdgAAkACAYJCF4AAwMAWBUBAAAOSAAGBgFYAAEBDwFJG0BlAAQDAgMEAm0AAgUDAgVrABMSERITEW0ABQAUEgUUYAASABEOEhFgAA4ADxAOD14AEAANCxANYAALAAoJCwpgAAwABwgMB2AACQAIBgkIXgADAwBYFQEAAA5IAAYGAVgAAQEPAUlZQDECANvY0M7Ix7u5sK6op5yaj42Egnt4bWtnZlhXUE5HRDMxKycjIRQSCgcADwIPFgUUKwEhIgYVERQWMyEyNjURLgEBNDY7ATI1NzU0KwEiJj0BNDY7ATIWHQEXFDsBMhYdARQGKwEiJjUTFA8BBh8BFh0BFA8BBisBIi8BNSY9ATQ7ATIWHQEUHwEzMDE1MDM3MDE2PQE0LwEjIiY0NjsBOAExNzM2PQE0LwEmKwE4ATEHFRQGKwEiLwE1ND8BMzY7ATIfAhYVNRQPAQYrATAxBxUHBh0BFBY7ATIWHQEUBisBIiY9ATc2PwE2OwEwMTc2MzU2PQE0LwEjMDEHFRQGKwEiJj0BND8BNjsBMh8BFh0BA3387y0/Pi4DES0/AT794QUDRwEBAjkDBQUDVwgKAQFGBAQEBL8DBeMFDQEBDQUFGAUHnA4FGgQNFQMFCAiGAQoCAg10CAoKCHYKAQEBCgEBhg8FAxgGAwIFGwEFB50IBgQWBQUYBQeUBwEBAgGxCAoKCMwICgECAhUFB5QGAQEBAQ98CQUDHgMFBRgFB5sMAhkGA1I+LfzuLT4+LQMSLT7+ygMFAgODBgQEGgQEDAmeAwIFAxsDBQUD/ngKBhAGBhMFChgJBiIFCCMBCQsNCgQECAMLDAEUAgMDBAERDBMMEQEEBQMBDQEYBgMFBQQOCgUlBgQEHAYK7AoGHgYKAQEBAhECBAsKAwkMDAk4CAkDGwUKAQECAgoDARIOCAMFBQMNCgUiBggjBgkeAAAAAAQAAP9qA+gDUgAPABkAIwBHAJBADDAnAgIDRTQCBwQCR0uwFVBYQDIABwQJBQdlAAkFBQljAAIABggCBmAACAAEBwgEXgADAwFYAAEBDkgABQUAWQAAAA8ASRtANAAHBAkEBwltAAkFBAkFawACAAYIAgZgAAgABAcIBF4AAwMBWAABAQ5IAAUFAFkAAAAPAElZQA5EQjMqOTMTMxI1MwoFHSsBERQGIyEGJjURNDYzITIWASE1NCYjISIGFQEhFRQWMyEyNjU3NC8BFRQGIyEiJj0BBwYdARceATsBNTQ2MyEyFh0BMzI3NjMD6D4t/O4tPj4tAxEuPv1DAXQOCv67Cg0BdP6MDQoBRgoNdQZRDQr+fgoOUAcBAwgIQw4KAYIKDUMJBwMBAuf87y49AT4uAxEtPj7+g9QKDQ0K/jdQCg4OCvsLBk0XCg4OChdNBQzJAwQGOQoNDQo5DAQAAAAEAAD/aQPpA1IADwAXAC8ARgDjS7ARUFhAOAAHBAIEB2UAAgYFAmMLAQYDBQZjAAMFBQNjAAgFAQUIZQAEBABYCQEAAA5ICgEFBQFZAAEBDwFJG0uwL1BYQDkABwQCBAdlAAIGBAIGawsBBgMFBmMAAwUFA2MACAUBBQhlAAQEAFgJAQAADkgKAQUFAVkAAQEPAUkbQDoABwQCBAdlAAIGBAIGawsBBgMFBmMAAwUFA2MACAUBBQgBbQAEBABYCQEAAA5ICgEFBQFZAAEBDwFJWVlAIRkYEBACADIxJyYYLxkvEBcQFxYVFBMSEQoHAA8CDwwFFCsBISIGFREUFjMhMjY1ES4BAScjByMTMxM3IicmNj8BNjc2JicuAT4BFx4BFxQGBwYXBiInJjQ3PgE1NCYnLgE+ARceARUWBgN9/O8uPj4uAxEuPgE+/h8buRtoqHKoXggMCwIMByoKCSksCgEPFwotNQMrKQx+CRUKBwcmKjMuCgEPFwo3PgEyA1I+LfzuLj4+LgMSLT79K01NAcL+Pg0KCB0HBzQ+Om8nBxcUAQgncj06ZykKHgoKCBkHKWc2PnEoBxcUAggwhklFfQAAAAL///9qA6EDDQAIACEAT0AKHwEBAA4BAwECR0uwKFBYQBgAAQADAgEDYAAAAARYAAQEDEgAAgIPAkkbQBYABAAAAQQAYAABAAMCAQNgAAICDwJJWbcXIxQTEgUFGSsBNC4BBhQWPgEBFAYiLwEGIyIuAj4EHgIXFAcXFgKDktCSktCSAR4sOhS/ZHtQkmhAAjxsjqSObDwBRb8VAYJnkgKWypgGjP6aHSoVv0U+apCijm46BEJmlk17ZL8VAAAAAAEAAAAAA6UCmAAVAB1AGg8BAAEBRwACAQJvAAEAAW8AAABmFBcUAwUXKwEUBwEGIicBJjQ/ATYyHwEBNjIfARYDpRD+IBAsEP7qDw9MECwQpAFuECwQTBACFhYQ/iAPDwEWECwQTBAQpQFvEBBMDwABAAD/7wLUAoYAJAArQCgiGRAHBAEDAUcAAwEAA1QAAgABAAIBYAADAwBYAAADAEwUHBQUBAUYKyUUDwEGIi8BBwYiLwEmND8BJyY0PwE2Mh8BNzYyHwEWFA8BFxYC1A9MECwQpKQQLBBMEBCkpBAQTBAsEKSkECwQTA8PpKQPcBYQTA8PpaUPD0wQLBCkpBAsEEwQEKSkEBBMDy4PpKQPAAAAAAEAAP/KA6EDQAAfAD1AChIPCgQDBQECAUdLsBVQWEAQAAIBAm8AAQENSAAAAA0ASRtADgACAQJvAAEAAW8AAABmWbUdFBcDBRcrARQPARMVFA4BLwEHBiImNTQ3EycmNTQ3JTc2Mh8BBRYDoQ/KMAwVDPv6DBYMATDLDh8BGH4LIAx9ARggAekMD8X+6QwLEAEHhIQHEgoECAEXxQ8MFQUo/hcX/igFAAIAAP/KA6EDQAAJACkASEARHBkUDg0JCAcGBQMBDAECAUdLsBVQWEAQAAIBAm8AAQENSAAAAA0ASRtADgACAQJvAAEAAW8AAABmWUAJJSQXFhIQAwUUKwE3LwEPARcHNxcTFA8BExUUIyIvAQcGIiY1NDcTJyY1NDclNzYyHwEFFgJ7qutqaeyrKdPT/g/KMBcKDPv6DBYMATDLDh8BGH4LIAx9ARggASKmItXVIqbrb28BsgwPxf7pDBwHhIQHEgoECAEXxQ8MFQUo/hcX/igFAAAAA////4kDqgMzABEANAA9AJm3JRcTAwMCAUdLsBVQWEAlAAIEAwQCA20AAwAGBQMGYQAEBABYAAAAEEgABQUBWAABAREBSRtLsBdQWEAiAAIEAwQCA20AAwAGBQMGYQAFAAEFAVwABAQAWAAAABAESRtAKAACBAMEAgNtAAAABAIABGAAAwAGBQMGYQAFAQEFVAAFBQFYAAEFAUxZWUAKExMuHSYXJAcFGysRND4CFzIeAg4ELgIBFzYzMhUUDwEGIgYnBw4BHQEzNTQ/ATI+Ajc+ATc0JiMiAxQWMjYuAgZKfqxhX658TAJIgKrBrnxMAU4fLi4yAgYEBg4CKBYMdQMGARQOGAYTFAFUQFUPKkMqAiZGKAFeX658TAFKfqzArIBIAUp+rgEOZR0WBQMIBQwCFQwaGCYaAwMGCAoKCRAoJDFE/o0gIiJAIgEkAAAAAv/8/8oDpgNAAAgAJABAQA0XEQoIBwUEAQgBAgFHS7AVUFhAEAACAQJvAAEBDUgAAAANAEkbQA4AAgECbwABAAFvAAAAZlm1GhQeAwUXKwE3LwIRHwEnJQcTFgYHIi8BBwYiJjcTJyY2NyU3NjIfAQUeAQKWj8YlaiGyKAEXyjACDA0JDfv6DRYOBDDLEgoZARh+CyAMfQEYGQwBPIwdBdX95xFe66zF/ukTFAEHhIQHFhIBF8USHgUo/hcX/igEIAAAAAEAAAAAAUECfQAOAAq3AAAAZhQBBRUrARQPAQYiJjURND4BHwEWAUEK+gscFhYcC/oKAV4OC/oLFg4B9A8UAgz6CgAAAgAA/7oDSAMCAAQAEgA+tAUAAgBFS7AVUFhAEAAAAgBvAAICAVgAAQENAUkbQBUAAAIAbwACAQECVAACAgFYAAECAUxZtSIoEQMFFysBESE+ATceARUUBiMiJichMjY1AXD+kBLO+pzS9rCg7BYBqBQeAwL+kJLOEBTuoK740p4cFgAAAf/9AAACnwLAABMAFUASCQEARQEBAABmAQAAEwESAgUUKzMiLwEmPgEWHwEBPgEXHgEHAQYj+SIWtBAILDoSdgEoEDYaGAwO/qIUJBzsGDgkCBiaAdoYDA4QNhr90CAABAAA/6ECaAMbACYA5wD0AQECN0AyurSyAxYSx6YCGBbWnAIME3g+AhcDakkCFQRgVwIJFQkBCAUbEgIABwhHCAYFBAIFAURLsAxQWEB+AA0YEwwNZQATDBQTYwAKFwQLCmUABBUDBGMAAAcCBwACbQACAQcCAWsAAQFuAAwACwMMC2EAFAADFxQDYQAYGgEXChgXYAAOAAkFDglgABIABQgSBWAZARUABwAVB2AAFhYQWAAQEBBIAAgID1gADw8MSAAGBhFYABERDAZJG0uwKFBYQIIADRgTGA0TbQATDBgTDGsAChcEFwoEbQAEFRcEFWsAAAcCBwACbQACAQcCAWsAAQFuAAwACwMMC2EAFAADFxQDYQAYGgEXChgXYAAOAAkFDglgABIABQgSBWAZARUABwAVB2AAFhYQWAAQEBBIAAgID1gADw8MSAAGBhFYABERDAZJG0CEAA0YExgNE20AEwwYEwxrAAoXBBcKBG0ABBUXBBVrAAAHAgcAAm0AAgEHAgFrAAEBbgAQABYYEBZgAAwACwMMC2EAFAADFxQDYQAYGgEXChgXYBkBFQkHFVQADgAJBQ4JYAASAAUIEgVgAA8ACAYPCGAAEQAGBxEGYBkBFRUHWAAHFQdMWVlBNAD2APUA6QDoAPwA+wD1AQEA9gEBAO8A7gDoAPQA6QD0AOcA5QDdANsAzgDMAMAAvgC3ALYArwCuAKMAogCYAJcAkQCPAIoAhwB/AH0AcQBvACYAGQAbABsAGwAtACUAJQAvABsABQAdKyUzFw8BJwcvATcWHwEWFxYzMjcXFhcWMzI3Nj8BFjMyNzY/ATY3FhMWFRQHBicjMRcWFx4BBgcGBwYjIicmLwEXFgcGBwYjIi8BFRYXFgcGBwYjIicmLwEVFgcGIicmNzUHBiMiJicmNzY/AQcGBwYjIicmJyY3Nj8BBwYHBiMiJyY3NDc2PwExIwYnJjQ3NhczJyYnJjc2MzIXFh8BJyY2NzYzMh8BJyYnJjc2NzYyFxYfATUmNjIWBxU3Njc2MzIXFhcWBwYHFTc2NzYzMhcWFxYHBg8CNzY3NjMyFxYXFgcGDwEzNgUyPgE0LgEiDgEUHgE3Ii4BND4BMh4BFA4BAfADdX1OaGhUeXcBCAEKHRITFgsECgYVGhgWBwkCDxQQFBsMAwcCAmcICAVOCREcDRcCAwQHDQoKBB4YBwQIOgQEDRITBi0MCwgPBQoQDQwIDQgNCAILCigLCwICIRAKHgoGDgkKAwUDDiYFEhIOAwIbEg8EBQYZHQMbDwgDGA0cEQdPBggIBk4LC0kBAwgOHAMdGQYFCTgGDhETCDQFAwoJDgYIEQ0XEwwIAQIVKRUCBQ4IDgkOCxIIBQ8ICwIIFhoFFBEMBQMTChcLAgQHGB4ECwkNBwkEAUgLDU3+4jRZNDRZaVo1NVo1KUYoKEZSRCcnROffC1ykpF4J4QkNAQ4PBwcDCQMMDAMJAwcHDRAFCwcCAScLFBENDAIHCwYMDQ8LEgkHEQ0FAgg1Cw4NEzINBBUWJQYOBQYYDR0QCE4FCQkFTgsFUAsOBiUXFAQCAhEqEw8MCB0UDQICBA4RIhQNBgwGCwcCDAksCAoCBBwNDRIhEQ4EAgk1GBAQOwQFFRYlCAkIBSQYFgMMTg4OTgkMHQ8aBQcKCCUUFwUECxYaEA4OBxQMFAsEAgUNEQYIExMMDRwEAus1WWlaNDRaaVk1LShFUUUoKEVRRSgAAAAAAwAA/2oD6ANTABQAHQA8ADxAOTUpIAMEBQFHAAMABQQDBV4AAgIAWAYBAAAOSAAEBAFYAAEBDwFJAQA0Mx8eGxoXFgsKABQBFAcFFCsBIgcGBwYQFxYXFiA3Njc2ECcmJyYDNjIWFAYiJjQTIzU3Mj8BNjc2PQE0JyYnJi8BJiM1NxcVFBceAjMB9Ih0cUNERENxdAEQdHFDRERDcXSyECwgHy0gk6sOBAUCCgIEBAMIBgkDCwSFBAQFDQwHA1JEQ3F0/vB0cUNERENxdAEQdHFDRP7kECAsIiIq/lIWAQIBBQYKB68ICgcGBAMBAxYIBe4MBQgHBAACAAD/nAJEAyAAKAAxAJ21CwEAAgFHS7AVUFhAJQACAQABAgBtAAAEAQAEawABAQNYAAMDEEgGAQQEBVgABQURBUkbS7AoUFhAIgACAQABAgBtAAAEAQAEawYBBAAFBAVcAAEBA1gAAwMQAUkbQCkAAgEAAQIAbQAABAEABGsAAwABAgMBYAYBBAUFBFQGAQQEBVgABQQFTFlZQA8qKS4tKTEqMSMTLjwHBRgrARYVFAcGDwEGBwYHFCsBIjU2Nz4BPwE2NzY1NCcmIyIHBhUjNjc2MzIDMhYOAS4BPgEB7lYqDEwuKAgGAhCAEAQYEEAYGBYMHBocQEQaHKYGbEZggoQsOgQ8WDoEPALkPnpAPBQ8HiIaEBwODGIaFjQQDhASLBooJiQsKjKiRir9SDxaNgI6XDYAAAABAAAAAANcAr4ADwAWQBMMBAIBRAAAAQBvAAEBZhQZAgUWKwEWFAcJASY0NzYyHwE3NjIDFkZG/pj+mEZGPrJAODo+sAKEQLhC/rYBSkK4QDo6NDQ6AAAAAv/8/70DRAMDABcAIwBItBMIAgBFS7AVUFhAEQAAAgBvAAICAVgDAQEBDQFJG0AWAAACAG8AAgEBAlQAAgIBWAMBAQIBTFlADRkYHxwYIxkiFxUEBRQrNy4BNxM+AR8BNz4BHgEHAw4BLwEHBiMiAyImPgEzITIWFAYjKCIKG9EaVCJ/kRxURgYZ0BpUIYCSHjMjERUgAhwXAtkVICAV2RxUIgEEIQoYYLUiCjhUIv78IAwZYbYo/vwgKh4eKiAAAv/9/7EDXwMLACQAMQCUQAkeFQwDBAIAAUdLsBVQWEAjAAEFAAABZQACAAMDAmUAAAAFWQAFBQxIAAMDBFkABAQRBEkbS7AoUFhAIAABBQAAAWUAAgADAwJlAAMABAMEXQAAAAVZAAUFDABJG0AmAAEFAAABZQACAAMDAmUABQAAAgUAYAADBAQDVAADAwRZAAQDBE1ZWUAJFRcUHBQZBgUaKyU0LwE3NjQvASYiDwEnJiIPAQYUHwEHBhQfARYyPwEXFjI/ATY3FA4BIi4CPgEyHgECgQplZQoKMwoeCmVlCx4KMgsLZWULCzIKHgtlZQoeCjMK2HLG6MhuBnq89Lp+4A4LZWULHQsyCwtlZQsLMgsdC2VlCx0LMgsLZWULCzILjXXEdHTE6sR0dMQAAAYAAP/5A+gDCwAPAB8ALwA/AE8AXwCMS7AoUFhANAAJAAgCCQhgAAMAAgEDAmAABQAEAAUEYAABAAABAFwACgoLWAALCwxIAAYGB1gABwcMBkkbQDgACwAKBgsKYAAHAAYDBwZgAAkACAIJCGAAAwACAQMCYAABBQABVAAFAAQABQRgAAEBAFgAAAEATFlAEl5bVlNOSzU1NTU1NTU1MwwFHSslFRQGByMiJic1NDYXMzIWExUUBicjIiYnNTQ2NzMyFgEVFAYHISImJzU0NhchMhYBFRQGKwEiJic1NDY7ATIWARUUBichIiYnNTQ2NyEyFhMVFAYjISImJzU0NjMhMhYBHiAWshceASAWshceASAWshceASAWshceAssgFv3pFx4BIBYCFxce/TcgFrIXHgEgFrIXHgLLIBb96RceASAWAhcXHgEgFv3pFx4BIBYCFxcemmwWHgEgFWwWIAEeAQZrFiABHhdrFx4BIP7NbBYeASAVbBYgAR4CJGsWICAWaxYgIP7MaxYgAR4XaxceASABCGsWICAWaxYgIAAACQAA//kD6AMLAA8AHwAvAD8ATwBfAG8AfwCPAMpLsChQWEBOAA8ADggPDmAACQAIAgkIYAADAAIBAwJgAAsACgQLCmAABQAEAAUEYAABAAABAFwAEBARWAAREQxIAAwMDVgADQ0MSAAGBgdYAAcHDAZJG0BQABEAEAwREGAADQAMBg0MYAAHAAYDBwZgAA8ADggPDmAACQAIAgkIYAADAAIBAwJgAAEFAAFUAAsACgQLCmAABQAEAAUEYAABAQBYAAABAExZQB6Oi4aDfnt2c25rZmNeW1ZTTks1NTU1NTU1NTMSBR0rJRUUBgcjIiYnNTQ2FzMyFhMVFAYnIyImJzU0NjczMhYBFRQGByMiJic1NDYXMzIWARUUBisBIiYnNTQ2OwEyFgEVFAYnIyImJzU0NjczMhYBFRQGByMiJj0BNDYXMzIWARUUBisBIiYnNTQ2OwEyFgEVFAYnIyImPQE0NjczMhYTFRQGKwEiJj0BNDY7ATIWAR4gFrIXHgEgFrIXHgEgFrIXHgEgFrIXHgFmIBayFx4BIBayFx7+nCAWshceASAWshceAWYgFrIXHgEgFrIXHgFmIBayFiAgFrIXHv6cIBayFx4BIBayFx4BZiAWshYgIBayFx4BIBayFiAgFrIXHppsFh4BIBVsFiABHgEGaxYgAR4XaxceASD+zWwWHgEgFWwWIAEeAiRrFiAgFmsWICD+zGsWIAEeF2sXHgEg/s1sFh4BIBVsFiABHgIkaxYgIBZrFiAg/sxrFiABHhdrFx4BIAEIaxYgIBZrFiAgAAAAAgAA/3wD6ANBAAUAKgApQCYkGxIJBAEAAUcCAQBFAwEBRAAAAQEAUgAAAAFWAAEAAUoTEAIFFisRIQERASMlND8BJyY0PwE2Mh8BNzYyHwEWFA8BFxYUDwEGIi8BBwYiLwEmATEBWf6n5QJ9AkxMAgI1AgYDTE0EBAM3AgJMTAICNwIGA01MAgYDNQICJwEa/DsBF3kEAkxMAggCNQICTEwCAjUCCAJMTAQGAjYCAk5OAgI2AgAAAAMAAP9tA+gDTwAFAA4AFgAxQC4JAQEAAUcTEgoDBABFFg4EAwFEAAABAQBSAAAAAVYCAQEAAUoAAAAFAAURAwUVKzURMwERASU2NCc3FhcUBxc2ECc3FhAH7AFi/p4BoElJR2kCay97e0yamo4BoAEh/B4BISNKzExKapSRZS93AWB7Spr+TJoAAAAAAwAAAAADjwKtAAUACQANACxAKQcGAgFFCQgCAEQAAQMAAVQAAwACAAMCXgABAQBYAAABAEwRFRMQBAUYKzciLgE2NzM3ESclIzUz8VyCAoZacN/fAi7f33+CuoIBb/1jb6hwAAL//f+xA18DCwAVACIAf7UHAQIBAUdLsBVQWEAfAAAEAQQAAW0AAQIEAQJrAAQEDEgAAgIDWQADAxEDSRtLsChQWEAcAAAEAQQAAW0AAQIEAQJrAAIAAwIDXQAEBAwESRtAHwAEAARvAAABAG8AAQIBbwACAwMCVAACAgNZAAMCA01ZWbcVFxcUFAUFGSsBNC8BJiIPAScmIg8BBhQfARYyNwE2FxQOASIuAj4BMh4BAs0KMwscC+R+CxwLMwoKygoeCwEvCoxyxujIbgZ6vPS6fgG4EAoyCwvjfgsLMgofCsoKCgEvCkt1xHR0xOrEdHTEAAABAAD/agPoA1IACwAGswcBAS0rAScJAQcJARcJATcBA+gs/jj+NysByf43KwHJAcgs/jgDJyv+OAHIK/43/jcrAcn+NysByQADAAD/agPoA1MAFAA4AFIAVEBRJAEDBjUBBQkCRwAEAAMHBANhAAcACAIHCGAABgAJBQYJYAACAAUAAgVgAAEBDkgKAQAADwBJAQBOTUpIQ0E+PTQxLCkjIBsZCwoAFAEUCwUUKwUyNzY3NhAnJicmIAcGBwYQFxYXFhM0JyYrASImPQE0NjsBMjc2JzU0JisBIgYdARQWOwEyNzYnNSU0LwEmIgYdASMiBh0BFBY7ARUUFjI/ATY1AfSIdHFDRERDcXT+8HRxQ0REQ3F0cwcECmkXIiIXcwkCAQEGBXMrPDwrcwkCAQEBTQfDBxMNoQkNDQmhDRMHwweWRENxdAEQdHFDRERDcXT+8HRxQ0QBRggDASEY/BciCgYNBgUGPCv8KzwKBQ0GwwkHwwcOCWcOCYoJDmcJDgfDBwkAAwAA/2oD6ANTABQALwA9AHlLsBlQWEApAAIGBAMCZQAEBwMEYwAGAAcDBgdhAAMABQADBWEAAQEOSAgBAAAPAEkbQCsAAgYEBgIEbQAEBwYEB2sABgAHAwYHYQADAAUAAwVhAAEBDkgIAQAADwBJWUAXAQA6OTQzLSolIx8eGRgLCgAUARQJBRQrBTI3Njc2ECcmJyYgBwYHBhAXFhcWATQnJiMiBwYHBiInJicmIyIHBhUUFjMhMjY1AzQuASIOARQeATI+ATUB9Ih0cUNERENxdP7wdHFDRERDcXQBghYgRQMPGRMgQiATGQ8DRR8XNCsBNis0ciU+Sj4lJT5KPiWWRENxdAEQdHFDRERDcXT+8HRxQ0QBUlA0SAoRCA8PCBEKSDRQKjIyKgE9JT8lJT9KPiUlPiUAAQAA/6oDEQMTAAsABrMHAgEtKwkBBiY1ETQ2FwEWFAME/RsNEhINAuUNAU3+ZAcKDwM2DgwI/mQHFAAAAgAA/7EDWgMLAA8AHwBqQAkYEAgABAIDAUdLsBVQWEAVAAEBDEgAAwMMSAACAhFIAAAAEQBJG0uwKFBYQBUAAgIDWAADAwxIAAAAAVgAAQEMAEkbQBgAAQMAAVQAAwACAAMCYAABAQBYAAABAExZWbY1NTUzBAUYKwERFAYjISImJxE0NjMhMhYFERQGIyEiJicRNDYzITIWA1kUEP7jDxQBFg4BHQ8W/gsUEP7jDxQBFg4BHQ8WAuf87g4WFg4DEg4WFg787g4WFg4DEg4WFgAAAAAD//n/sQOpAwsAUQBhAHEAqkAQOAEFAVABBAUPDQwDAgYDR0uwFVBYQCUABAAHBgQHYAAGAAIDBgJgAAUFAVgAAQEMSAADAwBYAAAAEQBJG0uwKFBYQCIABAAHBgQHYAAGAAIDBgJgAAMAAAMAXAAFBQFYAAEBDAVJG0AoAAEABQQBBV4ABAAHBgQHYAAGAAIDBgJgAAMAAANUAAMDAFgAAAMATFlZQBJubGZkXl1WVUtIRUI9OjUIBRUrARYHAw4BByEiJicmPwE2NzQmNTY/AT4BNzYmNj8BPgE3NiY3Nj8BPgE3NCY+AT8CPgE/AT4CFxU2MyEyFgcDDgEHISIGFxYzITI2NxM2JxYFBhYXITI2PwE2JichIgYPAQYWFyEyNj8BNiYHISIGBwOTFgyaCkAl/f0rUA8ODQEBAgQBBBINGAUCBAQHCgwWAwEEAgIKDQoaAwQCCAYKCQUGBgsFFBQQFQcBqSkuDZkUKDT+Gw8MBQ5DAgMQHgWnBAEV/boCBggBUwgOAgwCBgn+rQcOAjoDCAcBUwcOAwsDCAf+rQcOAwJHHyn+ByQwATwsJSIPDQcFDgQGBhoVPBUGFgsJDRQ+FAUYBAcKDQ5CFQQUCQwHCxEKFAoSCAoCBAEFQCj+BkImAREPJxIOAiYNEwgRBwoBDAYkBwoBDAazBwoBDAYkBwwBCggABAAA/7EDTQL/AAYAFAAZACQA4kAXHgECBR0WDgcEAwIZAwIDAAMBAQEABEdLsBJQWEAmAAIFAwUCA20AAwAFAwBrAAABAQBjAAUFDEgGAQEBBFcABAQNBEkbS7AVUFhAJwACBQMFAgNtAAMABQMAawAAAQUAAWsABQUMSAYBAQEEVwAEBA0ESRtLsChQWEAkAAIFAwUCA20AAwAFAwBrAAABBQABawYBAQAEAQRbAAUFDAVJG0AmAAUCBW8AAgMCbwADAANvAAABAG8GAQEEBAFSBgEBAQRXAAQBBEtZWVlAEgAAISAYFxAPCQgABgAGFAcFFSsXNycHFTMVATQjIgcBBhUUMzI3ATYnFwEjNQEUDwEnNzYyHwEWyzKDM0gBXwwFBP7RBA0FBAEvAx7o/jDoA00UXehdFDsWgxQHM4MzPEcCBgwE/tIEBgwEAS4Ecej+L+kBmh0VXelcFRWDFgAAAAACAAD/+QPoA1IAJwA/AHdAEygBAQYRAQIBNy4CBAIhAQUEBEdLsChQWEAmAAQCBQIEBW0ABQMCBQNrAAMAAAMAXQAGBg5IAAICAVgAAQEMAkkbQCQABAIFAgQFbQAFAwIFA2sAAQACBAECYAADAAADAF0ABgYOBklZQAo6GyU1NiUzBwUbKwEVFAYjISImNRE0NjchMhYdARQGIyEiBgcRFBYXITI2PQE0NjsBMhYTERQOAS8BAQYiLwEmNDcBJyY0NjMhMhYDEl5D/jBDXl5DAYkHCgoH/nclNAE2JAHQJTQKCCQICtYWHAti/pQFEARABgYBbGILFg4BHQ8UAUyyQ15eQwHQQl4BCggkCAo0Jf4wJTQBNiSyCAoKAdr+4w8UAgxi/pQGBkAFDgYBbGILHBYWAAIAAP+xA1oDCwAIAGoArEAVZVlMQQQABjsKAgEANCgbEAQDAQNHS7AVUFhAJQAGBAAEBgBtAAQAAwIEA2AAAAAFWAAFBQxIAAEBAlgAAgIRAkkbS7AoUFhAIgAGBAAEBgBtAAQAAwIEA2AAAQACAQJcAAAABVgABQUMAEkbQCgABgQABAYAbQAFAAABBQBgAAEDAgFUAAQAAwIEA2AAAQECWAACAQJMWVlAD1xbU1FJSCsqIiATEgcFFisBNCYiDgEWMjYlFRQGDwEGBxYXFhQHDgEnIi8BBgcGBwYrASImNScmJwcGIicmJyY0Nz4BNyYvAS4BJzU0Nj8BNjcmJyY0Nz4BMzIfATY3Njc2OwEyFh8BFhc3NjIXFhcWFAcOAQcWHwEeAQI7UnhSAlZ0VgEcCAdoCgsTKAYFD1ANBwdNGRoJBwQQfAgMEBsXTwYQBkYWBAUIKAoPCGYHCAEKBWgIDhclBgUPUA0HCE0YGgkIAxF8BwwBDxwXTwUPB0gUBAQJKAoPCGYHCgFeO1RUdlRUeHwHDAEQHhUbMgYOBhVQAQU8DQhMHBAKB2cJDDwFBkAeBQ4GDDIPHBsPAQwHfAcMARAZGiAtBwwHFFAFPA0ITBwQCgdnCQs7BQVDHAUOBgwyDxwaEAEMAAAAAAEAAAAAAjwB7QAOAB5AGwABAAEBRwABAAABVAABAQBYAAABAEw1FAIFFisBFA8BBiIvASY0NjMhMhYCOwr6CxwL+gsWDgH0DhYByQ4L+gsL+gscFhYAAAAPAAD/agOhA1IAAwAHAAsADwATABcAGwAfACMAMwA3ADsAPwBPAHMBnEANQSUCHRJJLSQDGyECR0uwClBYQKAAGyETIRsTbQATGR0TYwAXGQ0NF2UAAAECAgBlAAoCDgIKZQAOHAIOYwAhABkXIRleAB8ADQkfDV4AHQAJCB0JXgAYABURGBVeABYAEQcWEV4ADAAHBQwHXgAIAAUECAVeABQADwsUD14AEAALAxALXgAGAAMBBgNeAAQAAQAEAV4AGhogWAAgIA5IABISHlgAHh4OSAACAhxZABwcDxxJG0ChABshEyEbE20AExkhExlrABcZDQ0XZQAAAQICAGUACgIOAgplAA4cAg5jACEAGRchGV4AHwANCR8NXgAdAAkIHQleABgAFREYFV4AFgARBxYRXgAMAAcFDAdeAAgABQQIBV4AFAAPCxQPXgAQAAsDEAteAAYAAwEGA14ABAABAAQBXgAaGiBYACAgDkgAEhIeWAAeHg5IAAICHFkAHBwPHElZQD5ycG1qZ2ZjYF1bVlNNTEVEPz49PDs6OTg3NjU0MS8pJyMiISAfHh0cGxoZGBcWFRQTEhERERERERERECIFHSsXMzUjFzM1IyczNSMXMzUjJzM1IwEzNSMnMzUjATM1IyczNSMDNTQmJyMiBgcVFBY3MzI2ATM1IyczNSMXMzUjNzU0JicjIgYXFRQWNzMyNjcRFAYjISImNRE0NjsBNTQ2OwEyFh0BMzU0NjsBMhYHFTMyFkehocWyssWhocWyssWhoQGbs7PWsrIBrKGh1rOzxAwGJAcKAQwGJAcKAZuhodazs9ahoRIKCCMHDAEKCCMICtcsHPzuHSoqHUg0JSQlNNY2JCMlNgFHHSpPoaGhJLKysiSh/cSh+qH9xKEksgEwoQcKAQwGoQcMAQr+JrIkoaGha6EHCgEMBqEHDAEKLP01HSoqHQLLHSo2JTQ0JTY2JTQ0JTYqAAAABAAA/2oDoQNSAAMAEwAjAEcAs0AMFQUCBwIdDQIDCwJHS7AKUFhAQQAHAgkDB2UACQsDCWMACwMDC2MABQMBAwVlAAMAAQADAV8ABAQKWAAKCg5IAAICCFgACAgOSAAAAAZYAAYGDwZJG0BEAAcCCQIHCW0ACQsCCQtrAAsDAgsDawAFAwEDBWUAAwABAAMBXwAEBApYAAoKDkgAAgIIWAAICA5IAAAABlgABgYPBklZQBJGREE+OzozJTYmJiYkERAMBR0rFyERITc1NCYrASIGHQEUFjsBMjYlNTQmKwEiBh0BFBY7ATI2NxEUBiMhIiY1ETQ2OwE1NDY7ATIWHQEzNTQ2OwEyFgcVMzIWRwMS/O7XCggkCAoKCCQICgGsCggjCAoKCCMICtcsHPzuHSoqHUg0JSQlNNY2JCMlNgFHHSpPAjxroQgKCgihCAoKCKEICgoIoQgKCiz9NR0qKh0Cyx0qNiU0NCU2NiU0NCU2KgAAAv/9/7EDXwMLACMAMADEQAoNAQIBHwEEAwJHS7AVUFhAMgACAQABAgBtAAAFAQAFawAFAwEFA2sAAwQBAwRrAAEBB1gABwcMSAAEBAZZAAYGEQZJG0uwKFBYQC8AAgEAAQIAbQAABQEABWsABQMBBQNrAAMEAQMEawAEAAYEBl0AAQEHWAAHBwwBSRtANQACAQABAgBtAAAFAQAFawAFAwEFA2sAAwQBAwRrAAcAAQIHAWAABAYGBFQABAQGWQAGBAZNWVlACxUVIyQlIyQUCAUcKwE1NCYHIzU0JicjIgYHFSMiBhcVFBY3MxUUFhczMjY3NTMyNjcUDgEiLgI+ATIeAQKnFg6PFg5HDxQBjw4WARQPjxYORw8UAY8OFrJyxujIbgZ6vPS6fgE6SA4WAY8PFAEWDo8UD0gOFgGPDxQBFg6PFDN1xHR0xOrEdHTEAAAAAAP/9f+xA/MDUgAPACEAMwBcQAwbEQIDAgkBAgEAAkdLsBVQWEAdAAMAAAEDAGAAAgIFWAAFBQ5IAAEBBFgABAQRBEkbQBoAAwAAAQMAYAABAAQBBFwAAgIFWAAFBQ4CSVlACRc4JycmIwYFGislNTQmKwEiBh0BFBYXMzI2JxM0JyYrASIHBhUXFBY3MzI2AwEWBw4BByEiJicmNwE+ATIWAjsKB2wHCgoHbAcKAQoFBwd6BggFCQwHZwgMCAGsFBUJIhL8phIiCRUUAa0JIiYiU2oICgoIaggKAQzXAQEGBAYGBAj/BQgBBgIQ/O4jIxESARQQIyMDEhEUFAAAAAAG////agQvA1IAEQAyADsARABWAF8A7rZPDgIODwFHS7ARUFhAXAACCA8IAg9tAAUABwYFZQAHCgYHYwABCgwKAQxtAA4ADQAODWAAAwAABQMAYAALAAoBCwpgAA8ADAYPDGAAEBARWAAREQ5IAAgICVgACQkOSAAGBgRZAAQEDwRJG0BeAAIIDwgCD20ABQAHAAUHbQAHCgAHCmsAAQoMCgEMbQAOAA0ADg1gAAMAAAUDAGAACwAKAQsKYAAPAAwGDwxgABAQEVgAEREOSAAICAlYAAkJDkgABgYEWQAEBA8ESVlAHl5dWllWVFJQS0pJR0NCPz46ORkVFBk3IxMhEBIFHSsBBgcjIiY3NDMyHgE3MjcGFRQBFAYjISImJzQ+BTMyHgI+AT8BNjcyHgQXARQGIiY0NjIWARQGLgE+AhYFFAYnIyYnNjU0JxYzMj4BFzInFAYiJjQ2MhYBS1o6Sy1AAUUEKkIhJiUDAoNSQ/4YRFABBAwQICY6IQYkLkhQRhkpEAgiOCYgEA4B/cZUdlRUdlQBiX6wgAJ8tHoBQz4uSzlaLQMlJSFEKARFR1R2VFR2VAFeA0QsLMUWGgENFRBO/ltCTk5CHjhCODQmFhgcGgIWEBoKAhYmNDhCHAKPO1RUdlRU/u9ZfgJ6tngGhNMrLgFEA0FOEBUNGBgBjztUVHZUVAAABQAA/2oD6ANSAB8AIgAlADMAPABsQGkjAQAGHQEJACcgAgcFA0cMAQAACQUACV4ABQAHBAUHYAAEAAoIBApgAAgAAgsIAmAABgYDWAADAw5IDQELCwFYAAEBDwFJNDQBADQ8NDw7OTY1MC8uLCkoJSQiIRoXDgwJBgAfAR4OBRQrATIWFxEUBgchIiYnNSEiJicRNDY/AT4BOwEyFhcVNjMPATMBBzMXNzUjFRQGByMRITU0NgERIxUUBicjEQOyFx4BIBb96RceAf7RFx4BFhDkDzYW6BceASYhR6en/punp22w1h4X6QEeFgIm1x4X6AJ8IBb9WhceASAWoCAWAXcWNg/kEBYgFrcXd6cBfafCsOnpFh4B/puPFjb+TgKD6BYgAf6aAAAC////+QQwAwsAGAAzAH5ADCoBAQYxIwUDAgECR0uwKFBYQCkABgUBBQYBbQACAQABAgBtAAADAQADawADAAQDBF0AAQEFWAAFBQwBSRtALwAGBQEFBgFtAAIBAAECAG0AAAMBAANrAAUAAQIFAWAAAwQEA1QAAwMEWQAEAwRNWUAKIyg2FhQjIgcFGysBNCYrATU0JisBIgYdASMiBhQfARYyPwE2BRQGByEiJjc0NjcnNDYzMhYXNjMyFhUUBx4BAsoKCH0KB2wHCn0ICgXEBRAFxAUBZXxa/aFnlAFOQgGodleQISg1O1QXSF4BTAgKxAgKCgjEChAFxAUFxAZ2WXwBkmhIfB4YdqhiUCNUOysiEXYAAAAAAQAA/8ACmANEABQASLUBAQABAUdLsBVQWEALAAEBDkgAAAANAEkbS7AWUFhACwAAAAFYAAEBDgBJG0AQAAEAAAFUAAEBAFgAAAEATFlZtBcXAgUWKwkCFhQPAQYiJwEmNDcBNjIfARYUAo7+1wEpCgpdCxwL/mILCwGeCh4KXQoCqv7Y/tcKHgpdCgoBnwoeCgGeCwtdCh4AAAAAAQAA/8ACdANEABQASLUJAQABAUdLsBVQWEALAAEBDkgAAAANAEkbS7AWUFhACwAAAAFYAAEBDgBJG0AQAAEAAAFUAAEBAFgAAAEATFlZtBwSAgUWKwkBBiIvASY0NwkBJjQ/ATYyFwEWFAJq/mILHAtdCwsBKP7YCwtdCh4KAZ4KAWn+YQoKXQscCwEpASgLHAtdCwv+YgscAAAAAf/+/2oB+AMLACAAVUALGQEDAhwKAgEDAkdLsChQWEAaAAMCAQIDAW0AAQACAQBrAAICDEgAAAAPAEkbQBoAAwIBAgMBbQABAAIBAGsAAgIAWAAAAA8ASVm2GDY2FAQFGCsBFgcBBiMnLgE3EwcGIyInJjcTPgE7ATIWFRQHAzc2MzIB7goG/tIHEAgJCgJu4gIFCgcKA3ACDgi3Cw4CYN0FAgsCFgsN/XoOAQMQCAHDOAEHCA0BzQgKDgoEBv7+NgIAAAIAAP+xAsoDDAAVAB4At0uwElBYQCIAAQUDAgFlAAMEAgNjAAQEBVgABQUMSAACAgBZAAAAEQBJG0uwFVBYQCQAAQUDBQEDbQADBAUDBGsABAQFWAAFBQxIAAICAFkAAAARAEkbS7AoUFhAIQABBQMFAQNtAAMEBQMEawACAAACAF0ABAQFWAAFBQwESRtAJwABBQMFAQNtAAMEBQMEawAFAAQCBQRgAAIAAAJUAAICAFkAAAIATVlZWUAJExcRERcyBgUaKyUUBiMhIiY1ND4DFxYyNzIeAwMUBiIuATYeAQLKRjH+JDFGChgqPi1JykoqQiYcCI98tHoEgqyERTxYWDwwVFY8KAFISCY+VFYBwFh+frCAAnwAAAAAAQAA/7QDEAMIADYApkuwFVBYQCwAAgUGBQIGbQAGBAUGBGsABwAFAgcFYAADAwFYAAEBDEgABAQAWAAAAA0ASRtLsChQWEApAAIFBgUCBm0ABgQFBgRrAAcABQIHBWAABAAABABcAAMDAVgAAQEMA0kbQC8AAgUGBQIGbQAGBAUGBGsAAQADBwEDYAAHAAUCBwVgAAQAAARUAAQEAFgAAAQATFlZQAsmFyYlExUVIggFHCslFAYjIicBJjQ+ARcBFhQGIicBJiIGFhcBFjMyNjc0JwEmIyIGFB8BFhQGIi8BJjU0NjMyFwEWAxBaQEs4/k4/fLBAAVIFIhAF/q0sdFIBKgGxIy4kLgEj/rsOExAWDuUGJA4G5SNALTEjAUQ4TUFYNwGyQLB6AT/+rgUQIgUBUytUdSv+TyQwIy4jAUQOFiIP5AYQIgXlIjEuQCP+uzYAAAEAAAAAAUwCUQAVAB5AGwsBAAEBRwABAAABVAABAQBYAAABAEwcFAIFFisBFAcBBiIvASY0PwEnJjQ/ATYyFwEWAUwF/vsFDgYcBgbb2wYGHAUQBAEFBQE6BwX++wUFHAYOBtvcBQ4GHAYG/vwFAAABAAAAAAFeAlEAFQAeQBsDAQABAUcAAQAAAVQAAQEAWAAAAQBMFxkCBRYrARQPARcWFA8BBiInASY0NwE2Mh8BFgFeBtvbBgYcBQ4G/vwGBgEEBRAEHAYCIgcF3NsGDgYcBQUBBQUOBgEEBgYcBQAAAwAA/7ACPgMMABAAJwBbANVAEAUAAgABTUlFNjIuBgcEAkdLsBVQWEA0AAABBAEABG0ABwQFBAcFbQAFBgQFBmsAAgABAAIBYAADAwhYAAgIDEgABAQGWAAGBhEGSRtLsChQWEAxAAABBAEABG0ABwQFBAcFbQAFBgQFBmsAAgABAAIBYAAEAAYEBlwAAwMIWAAICAwDSRtANwAAAQQBAARtAAcEBQQHBW0ABQYEBQZrAAgAAwIIA2AAAgABAAIBYAAEBwYEUgAEBAZYAAYEBkxZWUAQWFdBQD49OzoaFyQUEgkFGSsBFAYiJjc0JiMiJj4BMzIeARc0LgIiDgIHFB8CFhczNjc+ATc2NxQHDgIHFhUUBxYVFAcWFRQGIw4CJiciJjc0NyY1NDcmNTQ3LgInJjU0PgMeAgGbDAwOAjwdBwwCCAkcNixYJj5MTEw+JgEmERFIB38IRwYWBiZHORkiIAMaDQ0ZCCQZCy4yMAkaJAEHGQ4OGgIiIBk6MlBoaGhONgIRCAoKCBkcChAKEiodKEQuGBguRCg5LBITVVFRVQYaBSw5Vz8bKkIbDx8UDw8VHRANDRocGRwCIBccGg0NEB0VDw8UHw8cQCwaP1c3YD4kAig6ZAAAAAACAAD/sQPoAwsAEQA3ALVACwsCAgYHAwEABAJHS7AVUFhAKwAHBQYFBwZtAAQCAAIEAG0ABQADAgUDYAAGAAIEBgJgAAEBDEgAAAANAEkbS7AoUFhAKwAHBQYFBwZtAAQCAAIEAG0ABQADAgUDYAAGAAIEBgJgAAAAAVgAAQEMAEkbQDAABwUGBQcGbQAEAgACBABtAAEFAAFUAAUAAwIFA2AABgACBAYCYAABAQBWAAABAEpZWUALJBMoIiMnGBYIBRwrExQHERQGByMiJicRJjU0NjIWBREUBgcGIyIuAiMiBwYjIiY3ETQ3Njc2MzIWFxYyNj8BNjMyFrMkCggkBwoBIyo6LAM0Dg94ViJGMlAna5gKCQ4WAREMIIRnPGhGFTpGGzEWCA8UAsMoFf09BwoBDAYCwxUoHioqQv5XDhAHQRgeGFEFFA8BnxENCBBDICELGA4aDBQAAAAIAAD/agNZA1IAEwAaACMAWQBeAGwAdwB+AMRAIBQBAgRsagIDCXRhVkkEBgNvJgIKBn40AgsKXAEIBwZHS7AyUFhAPgAJAgMCCQNtAAgHBQcIBW0AAgADBgIDYAAGAAoLBgpgAAsABwgLB2AABAQBWAABAQ5IDAEFBQBZAAAADwBJG0A8AAkCAwIJA20ACAcFBwgFbQABAAQCAQReAAIAAwYCA2AABgAKCwYKYAALAAcICwdgDAEFBQBZAAAADwBJWUAaGxt8e3p5UE04NzIwKScbIxsjEyYUNTYNBRkrAR4BFREUBgchIiYnETQ2NyEyFhcHFTMmLwEmExEjIiYnNSERARYXNjMyFxYHFCMHBiMiJicGBwYjIi8CJjc+ATc2FxYVNjc2Ny4BNzY7ATIXFgcGBxUGBxYBNjcOARMGFzY3NDc2NyImNTQnAzY3Ii8BJicGBwYFJiMWMzI3AzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+UwGsEh0hIFIRCQgBAQMkG0oke2BVMggHDgMGAgU2LggFAR0fJhQNCAgGEQwNBwoFAQEBBx/+8h0vHSjXCQcBAwQBAgEBB0ZMUwEGCSscDx8RAWANQSobCAICfhA0GP1+Fx4BIBYDfBceARYQJtIRBq8H/LACPCAV6fymAUsOEQQbDRABAhUWEg0hkgQHAgYOFzgaBQgBAS8/TEYuVhwWCAwaAwEWRCdb/vENSxYyAfEXMgQUAhYDAgIBDAj+jR4PBQglPTA+HwYNEAEAAAL//f+xA18DCwAeACsAjEuwFVBYQCQAAQACAAECbQACAwACA2sAAAAFWAAFBQxIAAMDBFkABAQRBEkbS7AoUFhAIQABAAIAAQJtAAIDAAIDawADAAQDBF0AAAAFWAAFBQwASRtAJwABAAIAAQJtAAIDAAIDawAFAAABBQBgAAMEBANUAAMDBFkABAMETVlZQAkVFxYWJhQGBRorATQvASYiDwEGFB8BISIGBxUUFjchBwYUHwEWMj8BNjcUDgEiLgI+ATIeAQLNCv0KHgozCgpq/ugPFAEWDgEYagoKMwoeCv0KjHLG6MhuBnq89Lp+AV4PCv0KCjMKHgpqFA9IDhYBagoeCjMKCv0KD3XEdHTE6sR0dMQAAAADAAD/sQR4AwwACAAsAE8BIkASLCUCCgcgHw4DBQYyEwIJCANHS7AVUFhASAAKBwwHCgxtAAsNAg0LAm0ADAANCwwNYAAGAAUDBgVeAAIAAwgCA2AOAQAAAVgAAQEMSAAICAlZAAkJEUgABwcEWAAEBBEESRtLsChQWEBDAAoHDAcKDG0ACw0CDQsCbQAMAA0LDA1gAAYABQMGBV4AAgADCAIDYAAIAAkECAlhAAcABAcEXA4BAAABWAABAQwASRtASQAKBwwHCgxtAAsNAg0LAm0ABwoEB1IAAQ4BAA0BAGAADAANCwwNYAAGAAUDBgVeAAIAAwgCA2AACAAJBAgJYQAHBwRYAAQHBExZWUAjAQBNS0pIRURBPzYzMS8pKCQiHBsXFRIQCgkFBAAIAQgPBRQrASImPgEeAgYFMzIWBxUUBisBFRQGByMiJj0BIyImJzU0NjczNTQ2FzMyFhcBFBY3MxUGIyEiJjU0PgUXMhceATI2NzYzMhcjIgYVAYlZfgJ6tngGhAHDxAcMAQoIxAwGawgKxQcKAQwGxQoIawcKAf5lKh2PJjn+GENSBAwSHiY6IQsLLFRkVCwLC0kwfR0qAV5+sIACfLR6SQwGawgKxQcKAQwGxQoIawcKAcQHDAEKCP6/HSwBhRxOQx44QjY4IhoCCiIiIiIKNiodAAMAAP+xBHIDDAAIACwATgEnQBBJAQAJJBsSAwMIMgEGAgNHS7AQUFhANwAHBQkIB2UACQAICWMKAQAAAVgAAQEMSAAEBANYAAMDDUgABQUCWAACAg1IAAgIBlkABgYRBkkbS7AVUFhAOQAHBQkFBwltAAkABQkAawoBAAABWAABAQxIAAQEA1gAAwMNSAAFBQJYAAICDUgACAgGWQAGBhEGSRtLsChQWEAyAAcFCQUHCW0ACQAFCQBrAAQAAwIEA2AABQACBgUCYAAIAAYIBl0KAQAAAVgAAQEMAEkbQDgABwUJBQcJbQAJAAUJAGsAAQoBAAgBAGAACAMGCFQABAADAgQDYAAFAAIGBQJgAAgIBlkABggGTVlZWUAbAQBIRkRDQT82MycmIiEVFBAPBQQACAEICwUUKwEiJj4BHgIGBRcWFA8BBiIvAQcGIi8BJjQ/AScmND8BNjIfATc2Mh8BFhQHBQcGFB8BBiMhIiY1ND4FFzIXFjI3NjMyFw4BBxQXAYlZfgJ6tngGhAIEiwUFTAUPBYuLBQ8FTAUFi4sFBUwFDwWLiwUPBUwFBf5fZRUVLgsN/hhDUgQMEh4mOiELC1a4VgsLDxAPDgEVAV5+sIACfLR6tYoFEAVMBQWLiwUFTAUQBYqLBRAFSwUFi4sFBUsFEAWLZRQ8FS4CTkMeOEI2OCIaAgpERAoEDxgUHhUAAAADAAD/+QPoAn0AEQAiADMAQEA9CwICBAINAQADAkcAAwQABAMAbQAGAAIEBgJgAAQAAAEEAGAAAQUFAVQAAQEFWQAFAQVNFxYkFBUYFgcFGysBJicWFRQGLgE1NDcGBx4BIDYBNCYHIgYVFBYyNjU0NjMyNgUUBwYEICQnJjQ3NiwBBBcWA6FVgCKS0JIigFVL4AEE4v63EAtGZBAWEEQwCxAB2QtO/vj+2v74TgsLTgEIASYBCE4LATqEQTpDZ5QCkGlDOkGEcoiIAUkLEAFkRQsQEAswRBDMExOBmpqBEyYUgJoCnn4UAAAAAAUAAP/DA+gCsQAJABoAPgBEAFcAvkAaNBsCAARTBgICAFJDAgECUEIpJwgBBgYBBEdLsApQWEAoAAUEBW8AAgABBAJlAAEGAAEGawAGAwAGA2sABAAAAgQAYAADAw0DSRtLsBVQWEApAAUEBW8AAgABAAIBbQABBgABBmsABgMABgNrAAQAAAIEAGAAAwMNA0kbQC8ABQQFbwACAAEAAgFtAAEGAAEGawAGAwAGA2sAAwNuAAQAAARUAAQEAFgAAAQATFlZQAtMSxMuGSQUHQcFGislNy4BNzQ3BgcWATQmByIGFRQWMjY1NDYzMjY3FBUGAg8BBiMiJyY1NDcuAScmNDc+ATMyFzc2MzIWHwEWBxYTFAYHExYXFAcGBw4BIzc+ATcmJzceARcWATYrMDgBIoBVXgFqEAtGZBAWEEQwCxDKO+o7HAUKB0QJGVCGMgsLVvyXMjIfBQoDDgskCwEJFVhJnQT6CxYnVNx8KXfIRUFdIzViIAtpTyNqPUM6QYSQAWcLEAFkRQsQEAswRBB1BAFp/lppMgknBgoHKiR4TREqEoOYCjYJBgYUBgEF/v1OgBsBGBleExMkLWBqSgqEaWRAPyRiNhMAAAAC//3/sQNfAwsAFAAhAGO1DQEBAAFHS7AVUFhAFQAAAANYAAMDDEgAAQECWAACAhECSRtLsChQWEASAAEAAgECXAAAAANYAAMDDABJG0AYAAMAAAEDAGAAAQICAVQAAQECWAACAQJMWVm2FRQcFgQFGCslNzY0LwEmIg8BBhQfAQcGFB8BFjIBFA4BIi4CPgEyHgEBkP4KCv4KHgo5CwurqwsLOQscAdRyxujIbgZ6vPS6fkj9CxwL/goKOQseCqurCxwLOQsBIXXEdHTE6sR0dMQAAAL//f+xA18DCwAUACEAY7UFAQEAAUdLsBVQWEAVAAAAA1gAAwMMSAABAQJYAAICEQJJG0uwKFBYQBIAAQACAQJcAAAAA1gAAwMMAEkbQBgAAwAAAQMAYAABAgIBVAABAQJYAAIBAkxZWbYVFBcbBAUYKyU3NjQvATc2NC8BJiIPAQYUHwEWMgEUDgEiLgI+ATIeAQH7OQsLq6sLCzkKHgr9Cwv9CxwBaXLG6MhuBnq89Lp+SDkKHgqrqwscDDkKCv4KHgr9CwEhdcR0dMTqxHR0xAAAAv/9/7EDXwMLABQAIQCFtREBAQABR0uwFVBYQB8AAQACAAECbQACAwACA2sAAAAEWAAEBAxIAAMDEQNJG0uwKFBYQB4AAQACAAECbQACAwACA2sAAwNuAAAABFgABAQMAEkbQCMAAQACAAECbQACAwACA2sAAwNuAAQAAARUAAQEAFgAAAQATFlZtxUUFBcWBQUZKyU3NjQvASYiDwEGFB8BFjI/ARcWMjcUDgEiLgI+ATIeAQKKOQsL/QscC/4KCjkLHAusqwsc2nLG6MhuBnq89Lp+1jkLHAz9Cwv9Cx4KOQoKrKwKknXEdHTE6sR0dMQAAAL//f+xA18DCwAUACEAf7UJAQIAAUdLsBVQWEAfAAEEAAQBAG0AAAIEAAJrAAQEDEgAAgIDWQADAxEDSRtLsChQWEAcAAEEAAQBAG0AAAIEAAJrAAIAAwIDXQAEBAwESRtAHwAEAQRvAAEAAW8AAAIAbwACAwMCVAACAgNZAAMCA01ZWbcVFBcUFgUFGSslNzY0LwEmIg8BJyYiDwEGFB8BFjIlFA4BIi4CPgEyHgEBxv0LCzkKHgqrrAoeCjkKCv4KHgGdcsboyG4Gerz0un59/goeCjkKCqysCgo5CxwL/grrdcR0dMTqxHR0xAAAAAIAAP+xA1sDCwAkAEcA20ATQyUCBgkvAQcGFwEDBAgBAQMER0uwFVBYQDcABwYFBgcFbQAEAgMCBANtAAkABQIJBWAABgYIWAAICAxIAAICAVgAAQENSAADAwBYAAAAEQBJG0uwKFBYQDIABwYFBgcFbQAEAgMCBANtAAkABQIJBWAAAgABAAIBYAADAAADAFwABgYIWAAICAwGSRtAOAAHBgUGBwVtAAQCAwIEA20ACAAGBwgGYAAJAAUCCQVgAAMBAANUAAIAAQACAWAAAwMAWAAAAwBMWVlADkZFJiUlNiUmNRQkCgUdKwEUFQ4BIyImJwcGIiY9ATQ2OwEyFgYPAR4BNzI2NzY3NjsBMhYTFRQGKwEiJjY/ASYjIgYHBgcGKwEiJjc1PgEzMhYXNzYyFgNLJOSZUZg8SAscFhYO+g4WAglNKGQ3SoInBhgEDGsICg4UEPoOFgIJTVJwS4InBhcFDG8HDAEk5plRmjxICxwYAQUDAZa6PjlICxYO+g4WFhwLTSQqAUo+CjgNDAG4+g4WFhwLTU1KPgo4DQwGBJa6PjlICxYAAAAAAwAA/2oDWQNSABMAGgAjAF21FAECBAFHS7AyUFhAHgACAAMFAgNgAAQEAVgAAQEOSAYBBQUAWAAAAA8ASRtAHAABAAQCAQReAAIAAwUCA2AGAQUFAFgAAAAPAElZQA4bGxsjGyMTJhQ1NgcFGSsBHgEVERQGByEiJicRNDY3ITIWFwcVMyYvASYTESMiJic1IREDMxAWHhf9EhceASAWAfQWNg9K0gUHrwbG6BceAf5TAn4QNBj9fhceASAWA3wXHgEWECbSEQavB/ywAjwgFen8pgACAAD/+QOgAwsALQBCAItACjsBBAYlAQUEAkdLsChQWEAwAAcBAgEHAm0ABgIEAgYEbQAEBQIEBWsABQMCBQNrAAMAAAMAXQACAgFYAAEBDAJJG0A2AAcBAgEHAm0ABgIEAgYEbQAEBQIEBWsABQMCBQNrAAEAAgYBAmAAAwAAA1QAAwMAWQAAAwBNWUALFBcVJzU5NTMIBRwrARUUBiMhIiY1ETQ2NyEyFx4BDwEGIycmIyEiBgcRFBYXITI2PQE0PwE2MzIXFhMBBiIvASY0PwE2Mh8BATYyHwEWFAMSXkP+MENeXkMB0CMeCQMHGwYHBQ0M/jAlNAE2JAHQJTQFJAYHAwQLgf45DSQO8A4OPQ4kDpMBaQ0kDj4NAUuxQ15eQwHQQl4BDgQTBhwFAQM0Jf4wJTQBNiSNCAUjBgIEAQX+Og4O8A0kDj4NDZMBaQ0NPQ4kAAAAAAQAAP9qA6EDUgATABwAIwBMAI9AEyMBBQNIR0ZEQ0JBPi0sCgYCAkdLsA1QWEAtCAEHBQIFBwJtAAYCBAQGZQAFAAIGBQJgAAMDAVgAAQEOSAAEBABZAAAADwBJG0AuCAEHBQIFBwJtAAYCBAIGBG0ABQACBgUCYAADAwFYAAEBDkgABAQAWQAAAA8ASVlAESQkJEwkTDQzERETJjUzCQUaKwERFAYjISImNRE0NjMhMhYfAR4BByMiJj0BIREhAzMmLwEmJwcGDwEGBwYPARUXFhcWFxYyNzY3Njc2JyYvAQcGByc3FwYHFzcnJi8BA6EgFv0SFiAgFgH0FjYQrg8XSOgWIP5UAsrW0gcGrgYRlwQIDYZDBgoFBQoGRIkRGBBqaQcDDQwHDw9IXi2dmzVFITGfCiZOGQIi/X0WHx8WA30XHxYQrhA2SyAW6PymAoMRBq8HBfQDBwuGRAUOBg8GDgVFiRAQaWoFBhEPCQ8PSF0unZs1RSAynwcnThUAAAIAAP/5A2sCwwAnAEAAO0A4FAECAQFHAAQDAAMEAG0AAQACBgECYAAGAAUDBgVgAAMEAANUAAMDAFgAAAMATBYjGSUqJScHBRsrJRQWDwEOAQcjIiY1ETQ2OwEyFhUXFg8BDgEnIyIGBxEUFhczMh4CARQHAQYiJj0BIyImPQE0NjczNTQ2FhcBFgFlAgECAQgIskNeXkOyCAoBAQECAQgIsiU0ATYktAYCBgICBgv+0QscFvoOFhYO+hYcCwEvCy4CEgUOCQQBXkMBiENeCggLCQYNBwgBNCb+eCU0AQQCCAEsDgv+0AoUD6EWDtYPFAGhDhYCCf7QCgAAAAEAAP/nA7YCKQAUAB1AGg0BAAIBRwABAgFvAAIAAm8AAABmFBcSAwUXKwkBBiInASY0PwE2MhcJATYyHwEWFAOr/mIKHgr+YgsLXQoeCgEoASgLHAxcCwGP/mMLCwGdCx4KXAsL/tgBKAsLXAscAAABAAAAAAO2AkYAFAAdQBoFAQECAUcAAgECbwABAAFvAAAAZhcUEgMFFyslBwYiJwkBBiIvASY0NwE2MhcBFhQDq1wLHgr+2P7YCxwLXQsLAZ4LHAsBngtrXAoKASn+1woKXAseCgGeCgr+YgscAAAAAgAA//kCgwMLAAcAHwBbS7AoUFhAHwADAAUAA2UABQIABWMAAAACAAJcAAEBBFgABAQMAUkbQCUAAwAFAANlAAUCAAVjAAQAAQAEAWAAAAMCAFIAAAACWAACAAJMWUAJIxMlNhMQBgUaKxMhNTQmDgEXBREUBgchIiYnETQ2FzM1NDYyFgcVMzIWswEdVHZUAQHQIBb96RceASAWEZTMlgISFx4BpWw7VAJQPaH+vhYeASAVAUIWIAFsZpSUZmweAAAAAAIAAP+9A00DCwAIAB0AWLUAAQEAAUdLsBVQWEAQAAAAAlgAAgIMSAABAQ0BSRtLsChQWEAQAAEAAXAAAAACWAACAgwASRtAFQABAAFwAAIAAAJUAAICAFgAAAIATFlZtTgaEgMFFysTNCYOAR4CNgEUBwEGIicBLgE9ATQ2NzMyFhcBFvoqOiwCKD4mAlUU/u4WOxT+cRUeKh3pHUgVAY8UAlgeKgImQCQGMP7ZHhX+7hUVAY8VSB3oHSoBHhX+cRUAAAAEAAD/sQNZAwsAAwAhADEARQDlQBErKiMiBAgEAUcNAQQGAQgCRkuwFVBYQDkABAcIBwRlAAIABQACZQAFCQAFYwAIAAMGCANgAAYAAQAGAV4ABwcKWAAKCgxIAAAACVgACQkRCUkbS7AoUFhANgAEBwgHBGUAAgAFAAJlAAUJAAVjAAgAAwYIA2AABgABAAYBXgAAAAkACVwABwcKWAAKCgwHSRtAPAAEBwgHBGUAAgAFAAJlAAUJAAVjAAoABwQKB2AACAADBggDYAAGAAEABgFeAAACCQBSAAAACVgACQAJTFlZQBBAPTg1FyYzERM7EREQCwUdKxchNSEFMxE0Ji8BLgEHFRQGIyEiJic1IxEzNTQ2MyEyFgcDNTQmKwEiBhcVFBY3MzI2BREUBiMhIiYnETQ2MyEyFh8BHgHWAa3+UwH0SAwFnQUcCB4X/r4WHgFISCAVAdEWIAHWCghrBwwBCghrBwwBZB4X/RIXHgEgFgIFFzYPnBAWB9bWAfQIGgecBgwB6BYgIBbo/TboFiAgFgEesggKCgiyBwwBCgr9+hYgIBYC7hYgGA6dDzYAAAAABP///7EELwMLAAgADwAfAC8AtEAXHRQCAQMPAQABDg0MCQQCABwVAgQCBEdLsBVQWEAmAAIABAACBG0AAQAAAgEAYAcBAwMGWAAGBgxIAAQEBVgABQURBUkbS7AoUFhAIwACAAQAAgRtAAEAAAIBAGAABAAFBAVcBwEDAwZYAAYGDANJG0ApAAIABAACBG0ABgcBAwEGA2AAAQAAAgEAYAAEBQUEVAAEBAVYAAUEBUxZWUASERAuKyYjGRcQHxEfExMSCAUXKwEUDgEmNDYeAQEVITU3FwElISIGBxEUFjchMjYnETQmFxEUBgchIiY3ETQ2NyEyFgFlPlo+Plo+Ajz87rJaAR0BHvyDBwoBDAYDfQcMAQpRNCX8gyQ2ATQlA30lNAIRLT4CQlZCBDr++vprs1kBHaEKCP1aBwwBCggCpggKEv1aJTQBNiQCpiU0ATYAAAEAAP9qAYoDUgAgADRAMQAEBQAFBABtAAABBQABawABAwUBA2sAAwIFAwJrAAUFDkgAAgIPAkkVISUVIRMGBRorARQGJyMRMzIeAQ8BBiIvASY0NjsBESMiJjY/ATYyHwEWAYkWDkdHDxQCDI8KHgqPChQPSEgOFgIJjwscC48LAp8OFgH9xBQeCo8LC48KHhQCPBQeC44LC44LAAMAAP9rA+cDTwAUAEoAUgEeQBJST04DBwY9PAIDBx8YAgIFA0dLsAlQWEAzAAYBBwEGB20AAwcEAgNlAAQFAgRjCQEFAgcFAmsABwcBWAABAQ5IAAICAFkIAQAADwBJG0uwClBYQDQABgEHAQYHbQADBwQHAwRtAAQFAgRjCQEFAgcFAmsABwcBWAABAQ5IAAICAFkIAQAADwBJG0uwKlBYQDUABgEHAQYHbQADBwQHAwRtAAQFBwQFawkBBQIHBQJrAAcHAVgAAQEOSAACAgBZCAEAAA8ASRtAMwAGAQcBBgdtAAMHBAcDBG0ABAUHBAVrCQEFAgcFAmsAAQAHAwEHXgACAgBZCAEAAA8ASVlZWUAbFRUBAFFQTUwVShVKR0ZDQhwbCwoAFAEUCgUUKwUiJyYnJhA3Njc2IBcWFxYQBwYHBicGFhcUFxYyNzY1PgE9ATQ/ATY3Njc2JyYnJgcGBwYHBhcWFxYXFhcVFBYzFxYzFhcWMwYHBgM3Mwc3ByM3AfWHdHFCRERCcXQBDnRxQkREQnF08gQMFyYTKxMsDgsSERUMHQkIWS0yLTYsIiUXLy8GDxEGGBQCBAchEA0MCBEZHxMGMlEyWH0ZPpVEQnF0AQ50cUJEREJxdP7ydHFCRP8XGQ4gDAoKCyEFDhJkMyUdIxE7NmlGHwkHCgkYGildXgwXGw0pL0UGBgILBAEBDQQCATmpZAzUjwAAAAAFAAD/bgOEA1IAEwAfACsANwBAAGBAXQ0BBgAFBAYFYAwBBAADAgQDYAsBAgAJCAIJYAAHBwBYCgEAAA5IDgEICAFYAAEBDwFJOTgtLCEgFRQBAD08OEA5QDMwLDctNickICshKhsYFB8VHgsIABMBEg8FFCsBMh4BFREUDgEjISIuATURND4BMwEyNjQmIyEiBhQWMyUyNjQmIyEiBhQWMyUyNjQmIyEiBhQWMxMyNjQmIgYUFgLlLEkqKkks/h4sSSoqSSwBdg8eGRT+lxMaGhMBzw8dGRP+MRMaGhMBzw8dGRP+MRMaGhPkHSIjOCMmA1IqSSz9WixJKipJLAKmLEkq/eUaJhkZJxmYGyUZGSYamBslGRkmGv1NIzkjIzgkAAAAAwAA/2sD5wNPABQAJAA3AIBADSglAgUEMTAvAwAGAkdLsCpQWEAmAAYFAAUGZQADAAQFAwReCAECAgFYAAEBDkgABQUAWAcBAAAPAEkbQCQABgUABQZlAAEIAQIDAQJgAAMABAUDBF4ABQUAWAcBAAAPAElZQBkXFQEAMzIuLCcmHxwVJBckCwoAFAEUCQUUKwUiJyYnJhA3Njc2IBcWFxYQBwYHBhMhIgYdARQWMyEyNj0BNCYDNSMVBwYUFjsBFRc3NTMyNjQnAfWHdHFCRERCcXQBDnRxQkREQnF0Bf7oCg0NCgEYCg0NObpDAwYFjAwMiwUHA5VEQnF0AQ50cUJEREJxdP7ydHFCRAMlDQouCg0NCi4KDf7Ov79CAwoH2yIi2wcKAwADAAD/awPnA08AFAAcACkAfEAMJSQjIiEgHwcFAQFHS7AqUFhAKAAFAQQBBQRtAAQGAQQGawAGAAIDBgJfAAEBDkgAAwMAWAcBAAAPAEkbQCMAAQUBbwAFBAVvAAQGBG8ABgACAwYCXwADAwBYBwEAAA8ASVlAFQEAKSgnJh4dGxgWFQsKABQBFAgFFCsFIicmJyYQNzY3NiAXFhcWEAcGBwYTIRQWMyEyNicjNwc1BycVJxcjFyEB9Yd0cUJEREJxdAEOdHFCRERCcXSd/bghFwHYFyEEn1GKS0yEUp2KASiVREJxdAEOdHFCRERCcXT+8nRxQkQBjRchIXyKUp6Li55SikwAAAAD//8AAAPiAqEAIAAzAFYAg7ZIOAIEBgFHS7ANUFhAKgAGAwQDBmUAAQADBgEDYAgBBAAFAgQFYAcBAgAAAlQHAQICAFYAAAIAShtAKwAGAwQDBgRtAAEAAwYBA2AIAQQABQIEBWAHAQIAAAJUBwECAgBWAAACAEpZQBg1NCIhUE5CPzRWNVYrKiEzIjMdGhgJBRUrARYUDwEGBwYHIyYnJicmJyYnJicmND8BNjc2NzMWFxYXATI3Njc2NCcuASIGBwYUFxYXFjcyNzY3FAcGBwYHBisBIicmJyY9ATY3Njc2FyMiBw4BFB4BA9gKCgdJTpWbMktLPz8yLyQcFgMKCgNAUJyfMp+cUED+IExBPyUmJiWAmIAlJiYlP0GOKCMfFAQHDhQgNDYHTzAkEAoIXRkhOjAMIhwbICA3AXYPEA8JX0J8DAYgHC4mMCQlGwgSEgoEV0SECAiERFf+yiYlP0GYQT9LSz9BmEE/JSbIGxgqEx0vGR8aKiogNCAcNVw2DgYJHRQSPkI6IwACAAD/awPnA08AFAAcAFC3GhkWAwIDAUdLsCpQWEAWAAMDAVgAAQEOSAACAgBYBAEAAA8ASRtAFAABAAMCAQNeAAICAFgEAQAADwBJWUAPAQAcGxgXCwoAFAEUBQUUKwUiJyYnJhA3Njc2IBcWFxYQBwYHBgE3AzMBBzcjAfWHdHFCRERCcXQBDnRxQkREQnF0/uKpijIBAa9ko5VEQnF0AQ50cUJEREJxdP7ydHFCRAHHIP7UAakTyAAAAAIAAP9rA+cDTwAUAFAAiEAQTEcaFQQCATgzLikEAAQCR0uwKlBYQC4AAgEGAQIGbQAGAwEGA2sAAwUBAwVrAAUEAQUEawABAQ5IAAQEAFkHAQAADwBJG0AlAAECAW8AAgYCbwAGAwZvAAMFA28ABQQFbwAEBABZBwEAAA8ASVlAFQEAREI9OzEwJiQfHQsKABQBFAgFFCsFIicmJyYQNzY3NiAXFhcWEAcGBwYDFRQGLwEXFgYjJxcWFA8BMzIWDwE3NhYdATc2Mh8BNTQ2HwEnJjY7AScmND8BIyImPwEHBiY9AQcGIicB9Yd0cUJEREJxdAEOdHFCRERCcXTwDwqPVwQHCa+cCQmcrwkIBV6dCRBXBRAEURAJll0FCAmvnAoKnK8JCAVdnAkQUQQQBZVEQnF0AQ50cUJEREJxdP7ydHFCRANorwoIBViWCg8GWAQQBVcOBZZYBQgKr5wKCqKvCQgFXZYJEFcFEARYDwqWWAUICq+dBAQAAAAAAv/9/7EDXwMLAA8AHABcS7AVUFhAFQAAAANYAAMDDEgAAQECWAACAhECSRtLsChQWEASAAEAAgECXAAAAANYAAMDDABJG0AYAAMAAAEDAGAAAQICAVQAAQECWAACAQJMWVm2FRU1JAQFGCsBNTQmByEiBhcVFBY3ITI2NxQOASIuAj4BMh4BAqcWDv5TDhYBFA8BrQ4WsnLG6MhuBnq89Lp+ATpIDhYBFA9IDhYBFDN1xHR0xOrEdHTEAAADAAD/agPoA1MAFAA8AGYAWUBWRQEDBVwlIiEEBwMCRwAGAQUBBgVtAAUDAQUDawAEBwIHBAJtAAIABwIAawADAAcEAwdhAAEBDkgIAQAADwBJAQBRUEtKSEc8Ox0cFxYLCgAUARQJBRQrBSInJicmEDc2NzYgFxYXFhAHBgcGAwYiJjQ/ATYyFx4BBxU3Njc2Jy4BBg8BDgEeAjY/ATY/ATY3BwYjEy4BBg8BBg8BNzYzNzYyFhQPAQYiJy4BNzY3BwYHBgcGFx4BNj8BPgEmAfSIdHFDRERDcXQBEHRxQ0REQ3F00B5VPB5uHlUeEA8CBwsKASUaQ0QabhkSEjNDRBlvBAgCBwENDQ/GGkNEGW8ECAkMDw1wHlU8Hm4eVR4QDwICAgMEBAsKASUaREMabhkSEpZEQ3F0ARB0cUNERENxdP7wdHFDRAEbHjxVHm4eHhArFwoFBAo3JxkSEhlvGURDMxISGW8ECwIIAwQDAVgZEhIZbgQLDgQDbx48VR5uHh4QKxcIAgEBAwQKNycZEhIZbxlEQwADAAAAAAPoAckADAAZACYAQkA/BgEAAgEAVAgBBAAFAwQFYAcBAgADAQIDYAYBAAABWAABAAFMGxoODQEAISAaJhsmFBMNGQ4ZBwYADAEMCQUUKwEyHgEUDgEiLgE0PgEhMh4BFA4BIi4BND4BITIeARQOASIuATQ+AQH0HTEdHTE6MR0dMf6UHTEdHTE6MR0dMQMvHTEdHTE6MR0dMQHJHTE6MR0dMToxHR0xOjEdHTE6MR0dMToxHR0xOjEdAAAIAAD/agPoA1MAFAAcACQALAA0ADwAfACEAN5A2yABCRkMGQkMbQAGFxgXBhhtAAwADQgMDWAACCIBGw4IG14ADgAPGg4PYAAaIQELEBoLXgAQABEKEBFgAAoeAQUSCgVeABIAEwQSE2AABB0BAxQEA14AFAAVAhQVYAACHwEHFgIHXgAWABcGFhdgABkZAVgAAQEOSAAYGABYHAEAAA8ASX19NTUtLSUlHR0VFQEAfYR9hIOBe3hzcG1rZ2ZlY19eXVtXVlVTT05NS0dGRUM/PjU8NTw7OS00LTQzMSUsJSwrKR0kHSQjIRUcFRwbGQsKABQBFCMFFCsFIicmJyYQNzY3NiAXFhcWEAcGBwYBIgYUFjsBNSciBhQWOwE1ByIGFBY7ATUDIgYUFjsBNQciBhQWOwE9ARUzMhYUBisBFTMyFhQGKwEVMzIWFAYrARUzMhYUBisBFTMyFhQGKwEVMzIWFAYrARUUFjMhMjY1ETQmIyEiBgciBhQWOwE1AfSIdHFDRERDcXQBEHRxQ0REQ3F0/ooFBwcFOjoFBwcFOjoFBwcFOjoFBwcFOjoFBwcFOlEFBwcFUVEFBwcFUVEFBwcFUVEFBwcFUVEFBwcFUVEFBwcFURsTAVITGxsT/q4TGzoFBwcFOpZEQ3F0ARB0cUNERENxdP7wdHFDRAGXBwoGF0YHCgYXjAYKBxcBXQcKBheLBwoHGLovBwoGLwYKBy4HCgcuBwoGLwcKBi8GCgcvExsbEwHSExsbiAYKBxcAAAAAAgAAAAAD6AJ8ACcAPwA+QDs8AQAFKyoaCQQEAQJHAAMFAgNUAAAAAQQAAWAABQAEAgUEYAADAwJYAAIDAkw5OC4tJSQdHBkYEAYFFSsBMhcWFxYXFh0BLwEmJyYnJicmJyYnJicmJxUUBiInASY0NwE2MhYVATEXFRQGIicBNyY0NyMBFTYyFh0BBwYUAjtNTHpGLBMVIQQFBwsNERQYHCAlKS80OgoOBf6/BwcBQQUOCv6LnwoOBf6+AQcHAQFCBQ4KnxMByRIdQykqLT07MQQFBggHCggKCAkHBwUEAaEHCwUBDAUPBwELBQoI/suFXgcLBQELAQUPBwEMAQUKCF6FEDIAAAAABQAA/28D5QNTABQAKQA4AEUATgBgQF0ABQAHCQUHYAAJDgEIBgkIYA0BBgwBBAIGBGAAAwMBWAABAQ5ICwECAgBYCgEAAA8ASUdGOjkrKhYVAQBLSkZOR05APzlFOkUxMCo4KzggHxUpFikLCgAUARQPBRQrBSInJicmEDc2NzYgFxYXFhAHBgcGJzI3Njc2NCcmJyYiBwYHBhQXFhcWNyIuATQ+ATIXHgEUBgcGJzI+ATQuASIOARQeATciJjQ2MhYUBgHyh3RxQkREQnF0AQ51cUJEREJxdYdrW1k0NjY0WVvWW1k0NjY0WVtrSn1JSX2UQD5JST5ASi5MLS1NWk0tLU0tGiYmNSYmkURCcXQBDnRxQkREQnF0/vJ0cUJEaTY0WVvWW1k0NjY0WVvWW1k0NnlJfZR9SSUkfZR9JCVpLU1aTS0tTVpNLWclNiYmNiUAAAIAAP/OA+gC7gAmADYAf0ANMCgCBwYVFAwDAgMCR0uwFVBYQCkABAcAAARlAAMBAgEDZQAFAAYHBQZgAAcAAAEHAGAAAQECWAACAg0CSRtALgAEBwAABGUAAwECAQNlAAUABgcFBmAABwAAAQcAYAABAwIBUgABAQJYAAIBAkxZQAsmJTUhKCYRJAgFHCsBERQHBiMhFTMyFh0BFAYjISInJj0BNDc2OwE1ISImNRE0NjMhMhYDETQmIyEiBhURFBYzITI2A+gYGyD+gLgHCQkH/k4FBwQEBwW4/oAhMjEiA0IiMUMJB/y+BwkKBgNCBgoCm/4MIxgZQgkIIQgJBQQIIQgEBUIxIwH0IjEx/eoB9AcJCQf+DAgJCQAAAQAA//AD6ALMAAkALUAqAAMCA28AAgECbwABAAABUgABAQBXBAEAAQBLAgAIBwYFBAMACQIJBQUUKwUpAREhNSE1IRECmv60/rIBTAFOAU4QARjj4f0kAAMAAP9qA8QDUwAMABoAQgCJQAwAAQIAAUcoGwIDAUZLsBVQWEAvAAEDBwUBZQAHBQUHYwADAAUAAwVgAAQECFgACAgOSAAAABFIAAICBlgABgYPBkkbQDIAAQMHBQFlAAcFBQdjAAAFAgUAAm0AAwAFAAMFYAAEBAhYAAgIDkgAAgIGWAAGBg8GSVlADB8iEigWESMTEgkFHSsFNCMiJjc0IhUUFjcyJSEmETQuAiIOAhUQBRQGKwEUBiImNSMiJjU+BDc0NjcmNTQ+ARYVFAceARcUHgMB/QkhMAESOigJ/owC1pUaNFJsUjQaAqYqHfpUdlT6HSocLjAkEgKEaQUgLCAFaoIBFiIwMGAIMCEJCSk6AamoASkcPDgiIjg8HP7XqB0qO1RUOyodGDJUXohNVJIQCgsXHgIiFQsKEJJUToZgUjQAAAADAAD/aAPoA1AAFAAkAEgAm0AMHhYCAwI4MAIGBwJHS7AtUFhAMgAIAwQECGUABwUGBQdlAAkAAgMJAmEAAwAEBQMEYAAFAAYABQZgAAEBDkgKAQAADwBJG0AyAAEJAW8ACAMEBAhlAAcFBgUHZQAJAAIDCQJhAAMABAUDBGAABQAGAAUGYAoBAAAPAElZQBsBAEdEPz08OjQyLCsqKCIgGhgLCgAUARQLBRQrBSInJicmEDc2NzYgFxYXFhAHBgcGExE0JiMhIgYVERQWMyEyNhMRFAYrARUzMhYdARQGIyEiJj0BNDY7ATUjIiY1ETQ2MyEyFgH0iHRwRERERHByARRycUNERENxdHkGBP4FBAYGBAH7BAYoHBbpbwQGBgT++QUFBQVv6RUeHhUB+xYcmEREcHYBDnRyQkREQnJ0/vJ2cEREAVsBMAQGBgT+0AQGBgE0/tAVHigGBBUEBgUFFQUFKB4VATAVHh4AAgAA//kDEwMLAA8AHwBJS7AoUFhAEwABAAIBAlwEAQAAA1gAAwMMAEkbQBkAAwQBAAEDAGAAAQICAVQAAQECWAACAQJMWUAPAgAeGxYTCgcADwIPBQUUKwEhIgYHERQWFyEyNjURNCYXERQGIyEiJjURNDY3ITIWAnH+MCU0ATYkAdAlNDR8XkP+MENeXkMB0EJgAsM0Jf4wJTQBNiQB0CU0Wf4wQ15eQwHQQl4BYAAB//n/sQMYAsMAFAA1tg4DAgABAUdLsBVQWEALAAEBAFgAAAARAEkbQBAAAQAAAVQAAQEAWAAAAQBMWbQ4JwIFFisBFgcBERQHBiMiLwEmNREBJjYzITIDDwkR/u0WBwcPCo8K/u0SExgCyhcCrRYR/u3+YhcKAwuPCw4BDwETESwAAAACAAD/agPEA1MADAA0AH1ACxoNAgEGAAECAAJHS7AVUFhAKwABBgUGAQVtAAUDBgUDawADAAYDAGsABgYOSAAAABFIAAICBFkABAQPBEkbQC0AAQYFBgEFbQAFAwYFA2sAAwAGAwBrAAACBgACawAGBg5IAAICBFkABAQPBElZQAofIhIjIxMSBwUbKwU0IyImNzQiFRQWNzIlFAYrARQGIiY1IyImNT4ENzQ2NyY1ND4BFhUUBx4BFxQeAwH9CSEwARI6KAkBxyod+lR2VPodKhwuMCQSAoRpBSAsIAVqggEWIjAwYAgwIQkJKToBqR0qO1RUOyodGDJUXohNVJIQCgsXHgIiFQsKEJJUToZgUjQAAAAB//3/jgGvA1IAFgBPtQwBAQIBR0uwFVBYQBoAAQIDAgEDbQADAAIDAGsAAgIOSAAAABEASRtAGgABAgMCAQNtAAMAAgMAawAAAAJYAAICDgBJWbYkIyQUBAUYKyUWDwEGIi8BJjY7ARE0NjsBMhYVETMyAasEB8MGDwXGCAoLfQoIawgKfQt9CgnXBQXXCRUCuAgKCgj9SAAAAAAB//7/agGvAy4AFgBPtQQBAQABR0uwHFBYQBoAAgMAAwIAbQAAAQMAAWsAAwMQSAABAQ8BSRtAGgACAwADAgBtAAABAwABawADAwFYAAEBDwFJWbYUJCMhBAUYKwEGKwERFAYrASImNREjIiY/ATYyHwEWAasFC30KCGsICn0MCAfDBQ8GxgcCPwv9SAgKCggCuBYI1wUF1wgAAAAEAAD/agNZA1IAEwAaACMAUwFgQAsUAQIEUjsCERACR0uwElBYQFoADwMMAw8MbQAMCwMMYwAGBwkFBmUACQUFCWMAAgADDwIDYAAQEwERChARXgALAAoICwpeAA0ACAcNCF4ADgAHBg4HXgAEBAFYAAEBDkgSAQUFAFkAAAAPAEkbS7AyUFhAXQAPAwwDDwxtAAwLAwwLawAGBwkHBgltAAkFBwkFawACAAMPAgNgABATAREKEBFeAAsACggLCl4ADQAIBw0IXgAOAAcGDgdeAAQEAVgAAQEOSBIBBQUAWQAAAA8ASRtAWwAPAwwDDwxtAAwLAwwLawAGBwkHBgltAAkFBwkFawABAAQCAQReAAIAAw8CA2AAEBMBEQoQEV4ACwAKCAsKXgANAAgHDQheAA4ABwYOB14SAQUFAFkAAAAPAElZWUAqJCQbGyRTJFNRUE9OTUxBQD8+PTw6OTg3NjUoJyYlGyMbIxMmFDU2FAUZKwEeARURFAYHISImJxE0NjchMhYXBxUzJi8BJhMRIyImJzUhETcVMzUjNz4CBzMUHwEeAR8BIxUzNSMnNzM1IxUzBw4BDwEjNCcmLwEzNSMVMxcHAzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+U6idKjoDBAYBAQMCAQQCPCujJmtsJpwpOQIIAQEBAwMGOyqiJmptAn4QNBj9fhceASAWA3wXHgEWECbSEQavB/ywAjwgFen8poM7O1oECgYBAgQEAgQDWjs7mJ47O1kECgMBAgMGB1k7O5ieAAAAAAYAAP9qA1kDUgATABoAIwA3AEsAWwB3QAsUAQIEQywCBwYCR0uwMlBYQCYAAgADBgIDYAAGAAcFBgdgAAQEAVgAAQEOSAgBBQUAWAAAAA8ASRtAJAABAAQCAQReAAIAAwYCA2AABgAHBQYHYAgBBQUAWAAAAA8ASVlAEhsbMzImJRsjGyMTJhQ1NgkFGSsBHgEVERQGByEiJicRNDY3ITIWFwcVMyYvASYTESMiJic1IRETNjIfARYUDwEXFgYPAQYiLwEmNyEWDwEOAS8BLgE/AScmNj8BNhYXAy4BNxM+AR8BHgEHAw4BJwMzEBYeF/0SFx4BIBYB9BY2D0rSBQevBsboFx4B/lPFBBAFHAcDZmYEAgYcBg4FfggIAj0ICH4EDgccBgIEZmYEAgYcBhAD3AcIAU0BDAgjBwgBTQEMBwJ+EDQY/X4XHgEgFgN8Fx4BFhAm0hEGrwf8sAI8IBXp/KYB9AcDFQUOBoiIBg4FFQQHqAsLCwuoBgIFFQUOBoiIBg4FFQQCBv5XAQ4GAdAHCAEFAgwH/jAHCAEAAAAABQAA/7EDEgMLAA8AHwAvADcAWwEaQBBLOQIKDSkhGREJAQYBAAJHS7AVUFhASQAECAIIBAJtAAACAQIAZQADAQUBA2UABQkBBWMACwAKCAsKXgANAAgEDQhgAAYAAgAGAmAABwcMWAAMDAxIAAEBCVgACQkRCUkbS7AoUFhARgAECAIIBAJtAAACAQIAZQADAQUBA2UABQkBBWMACwAKCAsKXgANAAgEDQhgAAYAAgAGAmAAAQAJAQlcAAcHDFgADAwMB0kbQEwABAgCCAQCbQAAAgECAGUAAwEFAQNlAAUJAQVjAAwABwYMB2AACwAKCAsKXgANAAgEDQhgAAYAAgAGAmAAAQMJAVQAAQEJWAAJAQlMWVlAFllYVVJPTUdGQ0AmIhMmJiYmJiMOBR0rJRE0JisBIgYVERQWOwEyNjcRNCYrASIGFREUFjsBMjY3ETQmKwEiBhURFBY7ATI2ATMnJicjBgcFFRQGKwERFAYjISImJxEjIiY9ATQ2OwE3PgE3MzIWHwEzMhYBHgoIJAgKCggkCAqPCggkCAoKCCQICo4KByQICgoIJAcK/tH6GwQFsQYEAesKCDY0Jf4wJTQBNQgKCgisJwksFrIXKgknrQgKUgGJCAoKCP53CAoKCAGJCAoKCP53CAoKCAGJCAoKCP53CAoKAjJBBQEBBVMkCAr97y5EQi4CEwoIJAgKXRUcAR4UXQoAAAAAAQAAAAEAAPekgjRfDzz1AAsD6AAAAADW7UmVAAAAANbtSZb/9f9mBkgDWwAAAAgAAgAAAAAAAAABAAADUv9qAAAGSP/1//UGSAABAAAAAAAAAAAAAAAAAAAAjQPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+j//APoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAExgAABCMAAAPoAAAD6AAABkgAAAPoAAADsQAAA+j//gPo//wFLQAAA+gAAATT//sDaQAAA+gAAAPoAAAD6AAAA+gAAAPoAAADoP//A+gAAAMRAAADoAAAA6AAAAOp//8DoP/8AWUAAANIAAACm//9AmgAAAPoAAACRAAAA1wAAAND//wDWf/9A+gAAAPoAAAD6AAAA+gAAAOgAAADWf/9A+gAAAPoAAAD6AAAAxEAAANZAAADoP/5A1kAAAPoAAADWQAAAjsAAAOgAAADoAAAA1n//QPo//UEL///A+gAAAQv//8CygAAAsoAAAH0//4CygAAAxEAAAFlAAABZQAAAjsAAAPoAAADWQAAA1n//QR2AAAEdgAAA+gAAAPoAAADWf/9A1n//QNZ//0DWf/9A1kAAANZAAADoAAAA+gAAAOgAAAD6AAAA+gAAAKCAAADWQAAA1kAAAQv//8BrAAAA+gAAAPoAAAD6AAAA+gAAAPo//8D6AAAA+gAAANZ//0D6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAADEQAAAxH/+QPoAAABrP/9Aaz//gNZAAADWQAAAxEAAAAAAAABpAIuAv4DdgPwBGoEwgT2BWAF4gYMBl4G1AemCBQIYAkKCWYJuAoYCl4KhgrwC7AMTgzqDU4Npg4UDlwPOA9MEFARJBFgEggThhPwFDAU6hU+FjAX3BiMGW4ZzhoGGlgarBsWG74cIBxCHIQctB9CH74gWiCGIOYhfiJOI3oj1iQcJE4kyCTsJYomJiZEJq4nsihkKP4p9CogK5AsSiz0LXQueC8ML5gv5jA0MJYxJDHOMgYyPjMsM9o0/jWKNoo3lDgKOPA5WjnEOj46tjuMO/Y8oj1iPeA+GD5QPrI/FD/uQJhA5kH2QohDHEOgRGZExEWCReBGrEcMSC5IsklcSepKFkq6S3BLyEwKTJRM4k0wTlpPKlA3AAEAAACNAQIADwAAAAAAAgBGAFYAcwAAAQALcAAAAAAAAAASAN4AAQAAAAAAAAA1AAAAAQAAAAAAAQAIADUAAQAAAAAAAgAHAD0AAQAAAAAAAwAIAEQAAQAAAAAABAAIAEwAAQAAAAAABQALAFQAAQAAAAAABgAIAF8AAQAAAAAACgArAGcAAQAAAAAACwATAJIAAwABBAkAAABqAKUAAwABBAkAAQAQAQ8AAwABBAkAAgAOAR8AAwABBAkAAwAQAS0AAwABBAkABAAQAT0AAwABBAkABQAWAU0AAwABBAkABgAQAWMAAwABBAkACgBWAXMAAwABBAkACwAmAclDb3B5cmlnaHQgKEMpIDIwMTggYnkgb3JpZ2luYWwgYXV0aG9ycyBAIGZvbnRlbGxvLmNvbXNzLWljb25zUmVndWxhcnNzLWljb25zc3MtaWNvbnNWZXJzaW9uIDEuMHNzLWljb25zR2VuZXJhdGVkIGJ5IHN2ZzJ0dGYgZnJvbSBGb250ZWxsbyBwcm9qZWN0Lmh0dHA6Ly9mb250ZWxsby5jb20AQwBvAHAAeQByAGkAZwBoAHQAIAAoAEMAKQAgADIAMAAxADgAIABiAHkAIABvAHIAaQBnAGkAbgBhAGwAIABhAHUAdABoAG8AcgBzACAAQAAgAGYAbwBuAHQAZQBsAGwAbwAuAGMAbwBtAHMAcwAtAGkAYwBvAG4AcwBSAGUAZwB1AGwAYQByAHMAcwAtAGkAYwBvAG4AcwBzAHMALQBpAGMAbwBuAHMAVgBlAHIAcwBpAG8AbgAgADEALgAwAHMAcwAtAGkAYwBvAG4AcwBHAGUAbgBlAHIAYQB0AGUAZAAgAGIAeQAgAHMAdgBnADIAdAB0AGYAIABmAHIAbwBtACAARgBvAG4AdABlAGwAbABvACAAcAByAG8AagBlAGMAdAAuAGgAdAB0AHAAOgAvAC8AZgBvAG4AdABlAGwAbABvAC4AYwBvAG0AAAAAAgAAAAAAAAAKAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACNAQIBAwEEAQUBBgEHAQgBCQEKAQsBDAENAQ4BDwEQAREBEgETARQBFQEWARcBGAEZARoBGwEcAR0BHgEfASABIQEiASMBJAElASYBJwEoASkBKgErASwBLQEuAS8BMAExATIBMwE0ATUBNgE3ATgBOQE6ATsBPAE9AT4BPwFAAUEBQgFDAUQBRQFGAUcBSAFJAUoBSwFMAU0BTgFPAVABUQFSAVMBVAFVAVYBVwFYAVkBWgFbAVwBXQFeAV8BYAFhAWIBYwFkAWUBZgFnAWgBaQFqAWsBbAFtAW4BbwFwAXEBcgFzAXQBdQF2AXcBeAF5AXoBewF8AX0BfgF/AYABgQGCAYMBhAGFAYYBhwGIAYkBigGLAYwBjQGOABNuYmxhc3RfbnVtYmVyY3J1bmNoCG5saWJyYXJ5B25iaW5kZXIIbnByb21wdHMJbm92ZXJ2aWV3C25ibGFzdF9pbmZvDG5ibGFzdF90b3AxMAtuYmxhc3RfeW91cgduc3luY3R2CG5yZWFkaW5nGG5ibGFzdF95b3VyYXZlcmFnZXJhdGluZxZuYmxhc3RfcmF0aW5nc3JlY2VpdmVkCG53cml0aW5nBm5za2lsbBNuYmxhc3RfcXVpY2tyZXN1bHRzDW5ub3RpZmljYXRpb24GbmludHJvBW5yZWFkBm50aGluawZud3JpdGUHbnJldmlldwduZGVmaW5lBm5tb2RlbAlueW91cnR1cm4GbnZvY2FiDm51c2luZ2xhbmd1YWdlCW5wcmFjdGljZQRtZW51CnBsYXktYXVkaW8EcGx1cwVwcmludApkb3duLW5vdGNoFGF1ZGlvLXRleHQtaGlnaGxpZ2h0CG51bWJlcmVkCmFubm90YXRpb24FaW50cm8EcmVhZAZzeW5jdHYFdGhpbmsFd3JpdGUSYW5ub3RhdGlvbi1jaXJjbGVkEnBsYXktYXVkaW8tY2lyY2xlZBBudW1iZXJlZC1jaXJjbGVkDXByaW50LWNpcmNsZWQcYXVkaW8tdGV4dC1oaWdobGlnaHQtY2lyY2xlZAZzZWFyY2gCb2sGY2FuY2VsBHN0YXIKc3Rhci1lbXB0eQxoZWxwLWNpcmNsZWQJc3Rhci1oYWxmCXJpZ2h0LWRpcgljaGFydC1waWUKY2hlY2stdGhpbgVhd2FyZARpbmZvBGhlbHAFaGVhcnQFY2hhcnQNY2xvc2UtY2lyY2xlZAd0aC1saXN0AnRoCnZvbHVtZS1vZmYGdm9sdW1lDXNsb3ctcGxheWJhY2sKb2stY2lyY2xlZApjbG9zZS10aGluB25sb2dvdXQIbnByb2ZpbGUEcGxheQVwYXVzZQRib29rBnBlbmNpbAhsaW5rLWV4dARnZWFyCGRvd24tZGlyCGNhbGVuZGFyCWNhbGVuZGFyMgxwbHVzLWNpcmNsZWQJYXR0ZW50aW9uBXVzZXJzBGRvY3MIZG93bmxvYWQJbGVmdC1vcGVuCnJpZ2h0LW9wZW4FZmxhc2gEdXNlcgZhdHRhY2gLYW5nbGUtcmlnaHQKYW5nbGUtbGVmdAlsaWdodGJ1bGIEZmxhZwhmaWxlLXBkZg1yaWdodC1jaXJjbGVkCXVzZXItcGx1cwp1c2VyLXRpbWVzA2V5ZQdleWUtb2ZmE2FuZ2xlLWNpcmNsZWQtcmlnaHQSYW5nbGUtY2lyY2xlZC1sZWZ0EGFuZ2xlLWNpcmNsZWQtdXASYW5nbGUtY2lyY2xlZC1kb3duB3JlZnJlc2gIZmlsZS1kb2MFY2hlY2sJZmlsZS1lcHViBmxvZ291dAlkb3duLW9wZW4HdXAtb3BlbgRsb2NrA3RhZwZmbG9wcHkHcGljdHVyZQ9yZXNpemUtdmVydGljYWwGbmlkZWFzCm5ib29rc2hlbGYMbmFzc2lnbm1lbnRzDG5uZXdmZWF0dXJlcw9ucmVjZW50bHl2aWV3ZWQPbmdldHRpbmdzdGFydGVkB25ibGFzdHMNbWludXMtY2lyY2xlZA9jb21wYXJlLWNpcmNsZWQEZG90cxBub3RlYm9vay1jaXJjbGVkCHJldmlzaW9uBnRhcmdldAJ0dglzY2FmZm9sZHMEYmVsbAp0di1jaXJjbGVkC2NoZWNrLWVtcHR5BmZpbHRlcghiZWxsLWFsdARkb3duAnVwCmZpbGUtZXhjZWwJZmlsZS1jb2RlBXRyYXNoAAAAAAEAAf//AA8AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAADCf/FA1v/ZgMc/6ADW/9msAAsILAAVVhFWSAgS7gADlFLsAZTWliwNBuwKFlgZiCKVViwAiVhuQgACABjYyNiGyEhsABZsABDI0SyAAEAQ2BCLbABLLAgYGYtsAIsIGQgsMBQsAQmWrIoAQpDRWNFUltYISMhG4pYILBQUFghsEBZGyCwOFBYIbA4WVkgsQEKQ0VjRWFksChQWCGxAQpDRWNFILAwUFghsDBZGyCwwFBYIGYgiophILAKUFhgGyCwIFBYIbAKYBsgsDZQWCGwNmAbYFlZWRuwAStZWSOwAFBYZVlZLbADLCBFILAEJWFkILAFQ1BYsAUjQrAGI0IbISFZsAFgLbAELCMhIyEgZLEFYkIgsAYjQrEBCkNFY7EBCkOwAWBFY7ADKiEgsAZDIIogirABK7EwBSWwBCZRWGBQG2FSWVgjWSEgsEBTWLABKxshsEBZI7AAUFhlWS2wBSywB0MrsgACAENgQi2wBiywByNCIyCwACNCYbACYmawAWOwAWCwBSotsAcsICBFILALQ2O4BABiILAAUFiwQGBZZrABY2BEsAFgLbAILLIHCwBDRUIqIbIAAQBDYEItsAkssABDI0SyAAEAQ2BCLbAKLCAgRSCwASsjsABDsAQlYCBFiiNhIGQgsCBQWCGwABuwMFBYsCAbsEBZWSOwAFBYZVmwAyUjYUREsAFgLbALLCAgRSCwASsjsABDsAQlYCBFiiNhIGSwJFBYsAAbsEBZI7AAUFhlWbADJSNhRESwAWAtsAwsILAAI0KyCwoDRVghGyMhWSohLbANLLECAkWwZGFELbAOLLABYCAgsAxDSrAAUFggsAwjQlmwDUNKsABSWCCwDSNCWS2wDywgsBBiZrABYyC4BABjiiNhsA5DYCCKYCCwDiNCIy2wECxLVFixBGREWSSwDWUjeC2wESxLUVhLU1ixBGREWRshWSSwE2UjeC2wEiyxAA9DVVixDw9DsAFhQrAPK1mwAEOwAiVCsQwCJUKxDQIlQrABFiMgsAMlUFixAQBDYLAEJUKKiiCKI2GwDiohI7ABYSCKI2GwDiohG7EBAENgsAIlQrACJWGwDiohWbAMQ0ewDUNHYLACYiCwAFBYsEBgWWawAWMgsAtDY7gEAGIgsABQWLBAYFlmsAFjYLEAABMjRLABQ7AAPrIBAQFDYEItsBMsALEAAkVUWLAPI0IgRbALI0KwCiOwAWBCIGCwAWG1EBABAA4AQkKKYLESBiuwcisbIlktsBQssQATKy2wFSyxARMrLbAWLLECEystsBcssQMTKy2wGCyxBBMrLbAZLLEFEystsBossQYTKy2wGyyxBxMrLbAcLLEIEystsB0ssQkTKy2wHiwAsA0rsQACRVRYsA8jQiBFsAsjQrAKI7ABYEIgYLABYbUQEAEADgBCQopgsRIGK7ByKxsiWS2wHyyxAB4rLbAgLLEBHistsCEssQIeKy2wIiyxAx4rLbAjLLEEHistsCQssQUeKy2wJSyxBh4rLbAmLLEHHistsCcssQgeKy2wKCyxCR4rLbApLCA8sAFgLbAqLCBgsBBgIEMjsAFgQ7ACJWGwAWCwKSohLbArLLAqK7AqKi2wLCwgIEcgILALQ2O4BABiILAAUFiwQGBZZrABY2AjYTgjIIpVWCBHICCwC0NjuAQAYiCwAFBYsEBgWWawAWNgI2E4GyFZLbAtLACxAAJFVFiwARawLCqwARUwGyJZLbAuLACwDSuxAAJFVFiwARawLCqwARUwGyJZLbAvLCA1sAFgLbAwLACwAUVjuAQAYiCwAFBYsEBgWWawAWOwASuwC0NjuAQAYiCwAFBYsEBgWWawAWOwASuwABa0AAAAAABEPiM4sS8BFSotsDEsIDwgRyCwC0NjuAQAYiCwAFBYsEBgWWawAWNgsABDYTgtsDIsLhc8LbAzLCA8IEcgsAtDY7gEAGIgsABQWLBAYFlmsAFjYLAAQ2GwAUNjOC2wNCyxAgAWJSAuIEewACNCsAIlSYqKRyNHI2EgWGIbIVmwASNCsjMBARUUKi2wNSywABawBCWwBCVHI0cjYbAJQytlii4jICA8ijgtsDYssAAWsAQlsAQlIC5HI0cjYSCwBCNCsAlDKyCwYFBYILBAUVizAiADIBuzAiYDGllCQiMgsAhDIIojRyNHI2EjRmCwBEOwAmIgsABQWLBAYFlmsAFjYCCwASsgiophILACQ2BkI7ADQ2FkUFiwAkNhG7ADQ2BZsAMlsAJiILAAUFiwQGBZZrABY2EjICCwBCYjRmE4GyOwCENGsAIlsAhDRyNHI2FgILAEQ7ACYiCwAFBYsEBgWWawAWNgIyCwASsjsARDYLABK7AFJWGwBSWwAmIgsABQWLBAYFlmsAFjsAQmYSCwBCVgZCOwAyVgZFBYIRsjIVkjICCwBCYjRmE4WS2wNyywABYgICCwBSYgLkcjRyNhIzw4LbA4LLAAFiCwCCNCICAgRiNHsAErI2E4LbA5LLAAFrADJbACJUcjRyNhsABUWC4gPCMhG7ACJbACJUcjRyNhILAFJbAEJUcjRyNhsAYlsAUlSbACJWG5CAAIAGNjIyBYYhshWWO4BABiILAAUFiwQGBZZrABY2AjLiMgIDyKOCMhWS2wOiywABYgsAhDIC5HI0cjYSBgsCBgZrACYiCwAFBYsEBgWWawAWMjICA8ijgtsDssIyAuRrACJUZSWCA8WS6xKwEUKy2wPCwjIC5GsAIlRlBYIDxZLrErARQrLbA9LCMgLkawAiVGUlggPFkjIC5GsAIlRlBYIDxZLrErARQrLbA+LLA1KyMgLkawAiVGUlggPFkusSsBFCstsD8ssDYriiAgPLAEI0KKOCMgLkawAiVGUlggPFkusSsBFCuwBEMusCsrLbBALLAAFrAEJbAEJiAuRyNHI2GwCUMrIyA8IC4jOLErARQrLbBBLLEIBCVCsAAWsAQlsAQlIC5HI0cjYSCwBCNCsAlDKyCwYFBYILBAUVizAiADIBuzAiYDGllCQiMgR7AEQ7ACYiCwAFBYsEBgWWawAWNgILABKyCKimEgsAJDYGQjsANDYWRQWLACQ2EbsANDYFmwAyWwAmIgsABQWLBAYFlmsAFjYbACJUZhOCMgPCM4GyEgIEYjR7ABKyNhOCFZsSsBFCstsEIssDUrLrErARQrLbBDLLA2KyEjICA8sAQjQiM4sSsBFCuwBEMusCsrLbBELLAAFSBHsAAjQrIAAQEVFBMusDEqLbBFLLAAFSBHsAAjQrIAAQEVFBMusDEqLbBGLLEAARQTsDIqLbBHLLA0Ki2wSCywABZFIyAuIEaKI2E4sSsBFCstsEkssAgjQrBIKy2wSiyyAABBKy2wSyyyAAFBKy2wTCyyAQBBKy2wTSyyAQFBKy2wTiyyAABCKy2wTyyyAAFCKy2wUCyyAQBCKy2wUSyyAQFCKy2wUiyyAAA+Ky2wUyyyAAE+Ky2wVCyyAQA+Ky2wVSyyAQE+Ky2wViyyAABAKy2wVyyyAAFAKy2wWCyyAQBAKy2wWSyyAQFAKy2wWiyyAABDKy2wWyyyAAFDKy2wXCyyAQBDKy2wXSyyAQFDKy2wXiyyAAA/Ky2wXyyyAAE/Ky2wYCyyAQA/Ky2wYSyyAQE/Ky2wYiywNysusSsBFCstsGMssDcrsDsrLbBkLLA3K7A8Ky2wZSywABawNyuwPSstsGYssDgrLrErARQrLbBnLLA4K7A7Ky2waCywOCuwPCstsGkssDgrsD0rLbBqLLA5Ky6xKwEUKy2wayywOSuwOystsGwssDkrsDwrLbBtLLA5K7A9Ky2wbiywOisusSsBFCstsG8ssDorsDsrLbBwLLA6K7A8Ky2wcSywOiuwPSstsHIsswkEAgNFWCEbIyFZQiuwCGWwAyRQeLABFTAtAEu4AMhSWLEBAY5ZsAG5CAAIAGNwsQAFQrIAAQAqsQAFQrMKBAEIKrEABUKzEAIBCCqxAAZCugLAAAEACSqxAAdCugBAAAEACSqxAwBEsSQBiFFYsECIWLEDZESxJgGIUVi6CIAAAQRAiGNUWLEDAERZWVlZswwEAQwquAH/hbAEjbECAEQAAA==") format("truetype"); }

/* Chrome hack: SVG is rendered more smooth in Windozze. 100% magic, uncomment if you need it. */
/* Note, that will break hinting! In other OS-es font will be not as sharp as it could be */
/*
  @media screen and (-webkit-min-device-pixel-ratio:0) {
	@font-face {
	  font-family: 'ss-icons';
	  src: url('../font/ss-icons.svg?17208830#ss-icons') format('svg');
	}
  }
  */
[class^="icon-"]:before, [class*=" icon-"]:before {
  font-family: "ss-icons";
  font-style: normal;
  font-weight: normal;
  speak: none;
  display: inline-block;
  text-decoration: inherit;
  width: 1em;
  margin-right: .2em;
  text-align: center;
  /* opacity: .8; */
  /* For safety - reset parent styles, that can break glyph codes*/
  font-variant: normal;
  text-transform: none;
  /* fix buttons height, for twitter bootstrap */
  line-height: 1em;
  /* Animation center compensation - margins should be symmetric */
  /* remove if not needed */
  margin-left: .2em;
  /* you can be more comfortable with increased icons size */
  /* font-size: 120%; */
  /* Uncomment for 3D effect */
  /* text-shadow: 1px 1px 1px rgba(127, 127, 127, 0.3); */ }

.icon-nblast_numbercrunch:before {
  content: '\32'; }

/* '2' */
.icon-nlibrary:before {
  content: '\33'; }

/* '3' */
.icon-nbinder:before {
  content: '\35'; }

/* '5' */
.icon-nprompts:before {
  content: '\36'; }

/* '6' */
.icon-noverview:before {
  content: '\37'; }

/* '7' */
.icon-nblast_info:before {
  content: '\38'; }

/* '8' */
.icon-nblast_top10:before {
  content: '\39'; }

/* '9' */
.icon-nblast_your:before {
  content: '\41'; }

/* 'A' */
.icon-nsynctv:before {
  content: '\42'; }

/* 'B' */
.icon-nreading:before {
  content: '\43'; }

/* 'C' */
.icon-nblast_youraveragerating:before {
  content: '\44'; }

/* 'D' */
.icon-nblast_ratingsreceived:before {
  content: '\45'; }

/* 'E' */
.icon-nwriting:before {
  content: '\46'; }

/* 'F' */
.icon-nskill:before {
  content: '\47'; }

/* 'G' */
.icon-nblast_quickresults:before {
  content: '\48'; }

/* 'H' */
.icon-nnotification:before {
  content: '\49'; }

/* 'I' */
.icon-nintro:before {
  content: '\4a'; }

/* 'J' */
.icon-nread:before {
  content: '\4b'; }

/* 'K' */
.icon-nthink:before {
  content: '\4c'; }

/* 'L' */
.icon-nwrite:before {
  content: '\4d'; }

/* 'M' */
.icon-nreview:before {
  content: '\4e'; }

/* 'N' */
.icon-ndefine:before {
  content: '\4f'; }

/* 'O' */
.icon-nmodel:before {
  content: '\50'; }

/* 'P' */
.icon-nyourturn:before {
  content: '\51'; }

/* 'Q' */
.icon-nvocab:before {
  content: '\52'; }

/* 'R' */
.icon-nusinglanguage:before {
  content: '\53'; }

/* 'S' */
.icon-npractice:before {
  content: '\54'; }

/* 'T' */
.icon-menu:before {
  content: '\e800'; }

/* '' */
.icon-play-audio:before {
  content: '\e801'; }

/* '' */
.icon-plus:before {
  content: '\e802'; }

/* '' */
.icon-print:before {
  content: '\e803'; }

/* '' */
.icon-down-notch:before {
  content: '\e804'; }

/* '' */
.icon-audio-text-highlight:before {
  content: '\e805'; }

/* '' */
.icon-numbered:before {
  content: '\e806'; }

/* '' */
.icon-annotation:before {
  content: '\e807'; }

/* '' */
.icon-intro:before {
  content: '\e808'; }

/* '' */
.icon-read:before {
  content: '\e809'; }

/* '' */
.icon-synctv:before {
  content: '\e80a'; }

/* '' */
.icon-think:before {
  content: '\e80b'; }

/* '' */
.icon-write:before {
  content: '\e80c'; }

/* '' */
.icon-annotation-circled:before {
  content: '\e80d'; }

/* '' */
.icon-play-audio-circled:before {
  content: '\e80e'; }

/* '' */
.icon-numbered-circled:before {
  content: '\e80f'; }

/* '' */
.icon-print-circled:before {
  content: '\e810'; }

/* '' */
.icon-audio-text-highlight-circled:before {
  content: '\e811'; }

/* '' */
.icon-search:before {
  content: '\e812'; }

/* '' */
.icon-ok:before {
  content: '\e813'; }

/* '' */
.icon-cancel:before {
  content: '\e814'; }

/* '' */
.icon-star:before {
  content: '\e815'; }

/* '' */
.icon-star-empty:before {
  content: '\e816'; }

/* '' */
.icon-help-circled:before {
  content: '\e817'; }

/* '' */
.icon-star-half:before {
  content: '\e818'; }

/* '' */
.icon-right-dir:before {
  content: '\e819'; }

/* '' */
.icon-chart-pie:before {
  content: '\e81a'; }

/* '' */
.icon-check-thin:before {
  content: '\e81b'; }

/* '' */
.icon-award:before {
  content: '\e81c'; }

/* '' */
.icon-info:before {
  content: '\e81d'; }

/* '' */
.icon-help:before {
  content: '\e81e'; }

/* '' */
.icon-heart:before {
  content: '\e81f'; }

/* '' */
.icon-chart:before {
  content: '\e820'; }

/* '' */
.icon-close-circled:before {
  content: '\e821'; }

/* '' */
.icon-th-list:before {
  content: '\e822'; }

/* '' */
.icon-th:before {
  content: '\e823'; }

/* '' */
.icon-volume-off:before {
  content: '\e824'; }

/* '' */
.icon-volume:before {
  content: '\e825'; }

/* '' */
.icon-slow-playback:before {
  content: '\e826'; }

/* '' */
.icon-ok-circled:before {
  content: '\e827'; }

/* '' */
.icon-close-thin:before {
  content: '\e828'; }

/* '' */
.icon-nlogout:before {
  content: '\e829'; }

/* '' */
.icon-nprofile:before {
  content: '\e82a'; }

/* '' */
.icon-play:before {
  content: '\e82b'; }

/* '' */
.icon-pause:before {
  content: '\e82c'; }

/* '' */
.icon-book:before {
  content: '\e82d'; }

/* '' */
.icon-pencil:before {
  content: '\e82e'; }

/* '' */
.icon-link-ext:before {
  content: '\e82f'; }

/* '' */
.icon-gear:before {
  content: '\e830'; }

/* '' */
.icon-down-dir:before {
  content: '\e831'; }

/* '' */
.icon-calendar:before {
  content: '\e832'; }

/* '' */
.icon-calendar2:before {
  content: '\e833'; }

/* '' */
.icon-plus-circled:before {
  content: '\e834'; }

/* '' */
.icon-attention:before {
  content: '\e835'; }

/* '' */
.icon-users:before {
  content: '\e836'; }

/* '' */
.icon-docs:before {
  content: '\e837'; }

/* '' */
.icon-download:before {
  content: '\e838'; }

/* '' */
.icon-left-open:before {
  content: '\e839'; }

/* '' */
.icon-right-open:before {
  content: '\e83a'; }

/* '' */
.icon-flash:before {
  content: '\e83b'; }

/* '' */
.icon-user:before {
  content: '\e83c'; }

/* '' */
.icon-attach:before {
  content: '\e83d'; }

/* '' */
.icon-angle-right:before {
  content: '\e83e'; }

/* '' */
.icon-angle-left:before {
  content: '\e83f'; }

/* '' */
.icon-lightbulb:before {
  content: '\e840'; }

/* '' */
.icon-flag:before {
  content: '\e841'; }

/* '' */
.icon-file-pdf:before {
  content: '\e842'; }

/* '' */
.icon-right-circled:before {
  content: '\e843'; }

/* '' */
.icon-user-plus:before {
  content: '\e844'; }

/* '' */
.icon-user-times:before {
  content: '\e845'; }

/* '' */
.icon-eye:before {
  content: '\e846'; }

/* '' */
.icon-eye-off:before {
  content: '\e847'; }

/* '' */
.icon-angle-circled-right:before {
  content: '\e848'; }

/* '' */
.icon-angle-circled-left:before {
  content: '\e849'; }

/* '' */
.icon-angle-circled-up:before {
  content: '\e84a'; }

/* '' */
.icon-angle-circled-down:before {
  content: '\e84b'; }

/* '' */
.icon-refresh:before {
  content: '\e84c'; }

/* '' */
.icon-file-doc:before {
  content: '\e84d'; }

/* '' */
.icon-check:before {
  content: '\e84e'; }

/* '' */
.icon-file-epub:before {
  content: '\e84f'; }

/* '' */
.icon-logout:before {
  content: '\e850'; }

/* '' */
.icon-down-open:before {
  content: '\e851'; }

/* '' */
.icon-up-open:before {
  content: '\e852'; }

/* '' */
.icon-lock:before {
  content: '\e853'; }

/* '' */
.icon-tag:before {
  content: '\e854'; }

/* '' */
.icon-floppy:before {
  content: '\e855'; }

/* '' */
.icon-picture:before {
  content: '\e856'; }

/* '' */
.icon-resize-vertical:before {
  content: '\e857'; }

/* '' */
.icon-nideas:before {
  content: '\e858'; }

/* '' */
.icon-nbookshelf:before {
  content: '\e859'; }

/* '' */
.icon-nassignments:before {
  content: '\e85a'; }

/* '' */
.icon-nnewfeatures:before {
  content: '\e85b'; }

/* '' */
.icon-nrecentlyviewed:before {
  content: '\e85c'; }

/* '' */
.icon-ngettingstarted:before {
  content: '\e85d'; }

/* '' */
.icon-nblasts:before {
  content: '\e85e'; }

/* '' */
.icon-minus-circled:before {
  content: '\e85f'; }

/* '' */
.icon-compare-circled:before {
  content: '\e860'; }

/* '' */
.icon-dots:before {
  content: '\e861'; }

/* '' */
.icon-notebook-circled:before {
  content: '\e862'; }

/* '' */
.icon-revision:before {
  content: '\e863'; }

/* '' */
.icon-target:before {
  content: '\e864'; }

/* '' */
.icon-tv:before {
  content: '\e865'; }

/* '' */
.icon-scaffolds:before {
  content: '\e866'; }

/* '' */
.icon-bell:before {
  content: '\e867'; }

/* '' */
.icon-tv-circled:before {
  content: '\e868'; }

/* '' */
.icon-check-empty:before {
  content: '\f096'; }

/* '' */
.icon-filter:before {
  content: '\f0b0'; }

/* '' */
.icon-bell-alt:before {
  content: '\f0f3'; }

/* '' */
.icon-down:before {
  content: '\f175'; }

/* '' */
.icon-up:before {
  content: '\f176'; }

/* '' */
.icon-file-excel:before {
  content: '\f1c3'; }

/* '' */
.icon-file-code:before {
  content: '\f1c9'; }

/* '' */
.icon-trash:before {
  content: '\f1f8'; }

/* '' */
/* Site */
html[platform=chrome] {
  overflow-y: scroll; }

@font-face {
  font-family: "ProximaNova";
  src: url("../vendor/proxima-nova/1132129/37994fca-b67e-41db-94b3-44077c62810a.eot?#iefix");
  src: url("../vendor/proxima-nova/1132129/37994fca-b67e-41db-94b3-44077c62810a.eot?#iefix") format("eot"), url("../vendor/proxima-nova/1132129/0583e751-caca-4cd8-af81-71b2aa5ddbbb.woff2") format("woff2"), url("../vendor/proxima-nova/1132129/da176885-bee9-49f7-88f0-d7ad9229ddd7.woff") format("woff"), url("../vendor/proxima-nova/1132129/1861a7b7-09a5-4efd-b681-5214784ded39.ttf") format("truetype");
  font-weight: 100; }

@font-face {
  font-family: "ProximaNova";
  src: url("../vendor/proxima-nova/1132144/93cc6d34-798e-42c8-87d2-fd6391801b63.eot?#iefix");
  src: url("../vendor/proxima-nova/1132144/93cc6d34-798e-42c8-87d2-fd6391801b63.eot?#iefix") format("eot"), url("../vendor/proxima-nova/1132144/d9fe41ee-4904-4a11-ba11-b61cd3be767f.woff2") format("woff2"), url("../vendor/proxima-nova/1132144/2fa30669-9bbd-4ced-912f-db94a367ed6c.woff") format("woff"), url("../vendor/proxima-nova/1132144/c12b3ebb-3771-483f-a84a-ac63d615c28e.ttf") format("truetype");
  font-weight: 300; }

@font-face {
  font-family: "ProximaNova";
  src: url("../vendor/proxima-nova/1132159/7e90123f-e4a7-4689-b41f-6bcfe331c00a.eot?#iefix");
  src: url("../vendor/proxima-nova/1132159/7e90123f-e4a7-4689-b41f-6bcfe331c00a.eot?#iefix") format("eot"), url("../vendor/proxima-nova/1132159/64017d81-9430-4cba-8219-8f5cc28b923e.woff2") format("woff2"), url("../vendor/proxima-nova/1132159/e56ecb6d-da41-4bd9-982d-2d295bec9ab0.woff") format("woff"), url("../vendor/proxima-nova/1132159/2aff4f81-3e97-4a83-9e6c-45e33c024796.ttf") format("truetype");
  font-weight: 400; }

@font-face {
  font-family: "ProximaNova";
  src: url("../vendor/proxima-nova/1529351/b918fc25-caba-4cf5-8606-d77742e476f4.eot?#iefix");
  src: url("../vendor/proxima-nova/1529351/b918fc25-caba-4cf5-8606-d77742e476f4.eot?#iefix") format("eot"), url("../vendor/proxima-nova/1529351/e898042a-5eb9-4810-b578-c3993ab58f0f.woff2") format("woff2"), url("../vendor/proxima-nova/1529351/cb9d4f02-d326-46b0-a857-930cce057f80.woff") format("woff"), url("../vendor/proxima-nova/1529351/75cafc03-22e4-41b0-8bc2-1b9081506ecc.ttf") format("truetype");
  font-weight: 500; }

@font-face {
  font-family: "ProximaNova";
  src: url("../vendor/proxima-nova/1132171/87e4b4fc-cdf1-450a-8bed-dd818cba908d.eot?#iefix");
  src: url("../vendor/proxima-nova/1132171/87e4b4fc-cdf1-450a-8bed-dd818cba908d.eot?#iefix") format("eot"), url("../vendor/proxima-nova/1132171/ae47a7f5-89da-4879-b934-29722c3dd451.woff2") format("woff2"), url("../vendor/proxima-nova/1132171/70ae52ec-d89b-4c6a-9402-854ebe423c54.woff") format("woff"), url("../vendor/proxima-nova/1132171/6a35571c-ea14-4dac-9ae1-0e7af0abeec8.ttf") format("truetype");
  font-weight: 600; }

@font-face {
  font-family: "ProximaNova";
  src: url("../vendor/proxima-nova/1132183/fbc6b03a-b3a1-427c-a884-053deca3a53c.eot?#iefix");
  src: url("../vendor/proxima-nova/1132183/fbc6b03a-b3a1-427c-a884-053deca3a53c.eot?#iefix") format("eot"), url("../vendor/proxima-nova/1132183/0d416408-95c6-4ad7-b08d-e60573d3b37d.woff2") format("woff2"), url("../vendor/proxima-nova/1132183/d999c07b-a049-4eb5-b8a6-4f36ae25e67e.woff") format("woff"), url("../vendor/proxima-nova/1132183/4d4a75f5-d32a-4a09-8665-133afd39cc37.ttf") format("truetype");
  font-weight: 700; }

/*
 * These need to be separate from the config because they have to be decalred AFTER we include neat
*/
/* Font Familys */
/* Headlines */
/* Text Sizes */
.row {
  display: block;
  clear: both;
  display: block;
  position: relative;
  margin-left: -12px;
  margin-right: -12px; }
  .row::after {
    clear: both;
    content: "";
    display: table; }
  .row > * {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    .row > *:last-child {
      margin-right: 0; }
    @media print {
      .row > * {
        float: left !important; } }

ul.row {
  padding: 0;
  list-style: none;
  display: block;
  clear: both;
  display: block;
  position: relative;
  margin-left: -12px;
  margin-right: -12px; }
  ul.row::after {
    clear: both;
    content: "";
    display: table; }
  ul.row > li, ul.row > dd {
    margin: 0; }
  ul.row::after {
    clear: both;
    content: "";
    display: table; }
  ul.row > * {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    ul.row > *:last-child {
      margin-right: 0; }
    @media print {
      ul.row > * {
        float: left !important; } }

/* Columns */
@media (min-width: 0) {
  [col-sm='1'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 4.80769%;
    width: 8.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='1']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='1'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='1'] {
    margin-left: 8.33333%; }
  [col-sm='2'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 13.46154%;
    width: 16.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='2']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='2'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='2'] {
    margin-left: 16.66667%; }
  [col-sm='3'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 22.11538%;
    width: 25%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='3']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='3'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='3'] {
    margin-left: 25%; }
  [col-sm='4'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 30.76923%;
    width: 33.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='4']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='4'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='4'] {
    margin-left: 33.33333%; }
  [col-sm='5'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 39.42308%;
    width: 41.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='5']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='5'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='5'] {
    margin-left: 41.66667%; }
  [col-sm='6'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 48.07692%;
    width: 50%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='6']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='6'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='6'] {
    margin-left: 50%; }
  [col-sm='7'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 56.73077%;
    width: 58.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='7']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='7'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='7'] {
    margin-left: 58.33333%; }
  [col-sm='8'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 65.38462%;
    width: 66.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='8']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='8'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='8'] {
    margin-left: 66.66667%; }
  [col-sm='9'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 74.03846%;
    width: 75%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='9']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='9'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='9'] {
    margin-left: 75%; }
  [col-sm='10'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 82.69231%;
    width: 83.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='10']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='10'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='10'] {
    margin-left: 83.33333%; }
  [col-sm='11'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 91.34615%;
    width: 91.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='11']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='11'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='11'] {
    margin-left: 91.66667%; }
  [col-sm='12'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-sm='12']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 0) {
    [col-sm='12'] {
      float: left !important; } }

@media (min-width: 0) {
  [offset-sm='12'] {
    margin-left: 100%; }
  [col-sm='hidden'] {
    display: none; } }

@media (max-width: 767px) {
  [col-sm='12'] + [col-sm='12'] {
    margin-top: 3rem; } }

@media (min-width: 768px) {
  [col-md='1'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 4.80769%;
    width: 8.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='1']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='1'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='1'] {
    margin-left: 8.33333%; }
  [col-md='2'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 13.46154%;
    width: 16.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='2']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='2'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='2'] {
    margin-left: 16.66667%; }
  [col-md='3'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 22.11538%;
    width: 25%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='3']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='3'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='3'] {
    margin-left: 25%; }
  [col-md='4'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 30.76923%;
    width: 33.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='4']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='4'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='4'] {
    margin-left: 33.33333%; }
  [col-md='5'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 39.42308%;
    width: 41.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='5']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='5'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='5'] {
    margin-left: 41.66667%; }
  [col-md='6'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 48.07692%;
    width: 50%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='6']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='6'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='6'] {
    margin-left: 50%; }
  [col-md='7'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 56.73077%;
    width: 58.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='7']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='7'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='7'] {
    margin-left: 58.33333%; }
  [col-md='8'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 65.38462%;
    width: 66.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='8']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='8'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='8'] {
    margin-left: 66.66667%; }
  [col-md='9'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 74.03846%;
    width: 75%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='9']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='9'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='9'] {
    margin-left: 75%; }
  [col-md='10'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 82.69231%;
    width: 83.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='10']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='10'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='10'] {
    margin-left: 83.33333%; }
  [col-md='11'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 91.34615%;
    width: 91.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='11']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='11'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='11'] {
    margin-left: 91.66667%; }
  [col-md='12'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-md='12']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 768px) {
    [col-md='12'] {
      float: left !important; } }

@media (min-width: 768px) {
  [offset-md='12'] {
    margin-left: 100%; }
  [col-md='hidden'] {
    display: none; } }

@media (min-width: 768px) and (max-width: 849px) {
  [col-md='12'] + [col-md='12'] {
    margin-top: 3rem; } }

@media (min-width: 850px) {
  [col-lg='1'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 4.80769%;
    width: 8.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='1']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='1'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='1'] {
    margin-left: 8.33333%; }
  [col-lg='2'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 13.46154%;
    width: 16.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='2']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='2'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='2'] {
    margin-left: 16.66667%; }
  [col-lg='3'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 22.11538%;
    width: 25%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='3']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='3'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='3'] {
    margin-left: 25%; }
  [col-lg='4'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 30.76923%;
    width: 33.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='4']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='4'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='4'] {
    margin-left: 33.33333%; }
  [col-lg='5'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 39.42308%;
    width: 41.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='5']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='5'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='5'] {
    margin-left: 41.66667%; }
  [col-lg='6'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 48.07692%;
    width: 50%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='6']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='6'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='6'] {
    margin-left: 50%; }
  [col-lg='7'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 56.73077%;
    width: 58.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='7']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='7'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='7'] {
    margin-left: 58.33333%; }
  [col-lg='8'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 65.38462%;
    width: 66.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='8']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='8'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='8'] {
    margin-left: 66.66667%; }
  [col-lg='9'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 74.03846%;
    width: 75%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='9']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='9'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='9'] {
    margin-left: 75%; }
  [col-lg='10'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 82.69231%;
    width: 83.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='10']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='10'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='10'] {
    margin-left: 83.33333%; }
  [col-lg='11'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 91.34615%;
    width: 91.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='11']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='11'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='11'] {
    margin-left: 91.66667%; }
  [col-lg='12'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-lg='12']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 850px) {
    [col-lg='12'] {
      float: left !important; } }

@media (min-width: 850px) {
  [offset-lg='12'] {
    margin-left: 100%; }
  [col-lg='hidden'] {
    display: none; } }

@media (min-width: 850px) and (max-width: 1149px) {
  [col-lg='12'] + [col-lg='12'] {
    margin-top: 3rem; } }

@media (min-width: 1150px) {
  [col-xl='1'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 4.80769%;
    width: 8.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='1']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='1'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='1'] {
    margin-left: 8.33333%; }
  [col-xl='2'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 13.46154%;
    width: 16.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='2']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='2'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='2'] {
    margin-left: 16.66667%; }
  [col-xl='3'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 22.11538%;
    width: 25%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='3']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='3'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='3'] {
    margin-left: 25%; }
  [col-xl='4'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 30.76923%;
    width: 33.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='4']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='4'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='4'] {
    margin-left: 33.33333%; }
  [col-xl='5'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 39.42308%;
    width: 41.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='5']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='5'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='5'] {
    margin-left: 41.66667%; }
  [col-xl='6'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 48.07692%;
    width: 50%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='6']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='6'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='6'] {
    margin-left: 50%; }
  [col-xl='7'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 56.73077%;
    width: 58.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='7']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='7'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='7'] {
    margin-left: 58.33333%; }
  [col-xl='8'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 65.38462%;
    width: 66.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='8']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='8'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='8'] {
    margin-left: 66.66667%; }
  [col-xl='9'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 74.03846%;
    width: 75%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='9']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='9'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='9'] {
    margin-left: 75%; }
  [col-xl='10'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 82.69231%;
    width: 83.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='10']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='10'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='10'] {
    margin-left: 83.33333%; }
  [col-xl='11'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 91.34615%;
    width: 91.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='11']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='11'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='11'] {
    margin-left: 91.66667%; }
  [col-xl='12'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-xl='12']:last-child {
      margin-right: 0; } }
  @media print and (min-width: 1150px) {
    [col-xl='12'] {
      float: left !important; } }

@media (min-width: 1150px) {
  [offset-xl='12'] {
    margin-left: 100%; }
  [col-xl='hidden'] {
    display: none; } }

@media (min-width: xlarge) {
  [col-xl='12'] + [col-xl='12'] {
    margin-top: 3rem; } }

@media print {
  [col-print='1'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 4.80769%;
    width: 8.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='1']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='1'] {
      float: left !important; } }

@media print {
  [offset-print='1'] {
    margin-left: 8.33333%; }
  [col-print='2'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 13.46154%;
    width: 16.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='2']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='2'] {
      float: left !important; } }

@media print {
  [offset-print='2'] {
    margin-left: 16.66667%; }
  [col-print='3'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 22.11538%;
    width: 25%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='3']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='3'] {
      float: left !important; } }

@media print {
  [offset-print='3'] {
    margin-left: 25%; }
  [col-print='4'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 30.76923%;
    width: 33.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='4']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='4'] {
      float: left !important; } }

@media print {
  [offset-print='4'] {
    margin-left: 33.33333%; }
  [col-print='5'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 39.42308%;
    width: 41.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='5']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='5'] {
      float: left !important; } }

@media print {
  [offset-print='5'] {
    margin-left: 41.66667%; }
  [col-print='6'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 48.07692%;
    width: 50%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='6']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='6'] {
      float: left !important; } }

@media print {
  [offset-print='6'] {
    margin-left: 50%; }
  [col-print='7'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 56.73077%;
    width: 58.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='7']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='7'] {
      float: left !important; } }

@media print {
  [offset-print='7'] {
    margin-left: 58.33333%; }
  [col-print='8'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 65.38462%;
    width: 66.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='8']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='8'] {
      float: left !important; } }

@media print {
  [offset-print='8'] {
    margin-left: 66.66667%; }
  [col-print='9'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 74.03846%;
    width: 75%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='9']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='9'] {
      float: left !important; } }

@media print {
  [offset-print='9'] {
    margin-left: 75%; }
  [col-print='10'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 82.69231%;
    width: 83.33333%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='10']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='10'] {
      float: left !important; } }

@media print {
  [offset-print='10'] {
    margin-left: 83.33333%; }
  [col-print='11'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 91.34615%;
    width: 91.66667%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='11']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='11'] {
      float: left !important; } }

@media print {
  [offset-print='11'] {
    margin-left: 91.66667%; }
  [col-print='12'] {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    [col-print='12']:last-child {
      margin-right: 0; } }
  @media print {
    [col-print='12'] {
      float: left !important; } }

@media print {
  [offset-print='12'] {
    margin-left: 100%; }
  [col-print='hidden'] {
    display: none; } }

[col-right] {
  float: right; }

[col-centered] {
  display: block;
  float: none !important;
  margin-left: auto !important;
  margin-right: auto !important; }

/* ==========================================================================
   Typography
   ========================================================================== */
* {
  -webkit-font-smoothing: antialiased;
  -moz-osx-font-smoothing: grayscale;
  font-smoothing: antialiased;
  text-rendering: optimizeLegibility; }

html {
  font-size: 8.5px;
  line-height: 8.5px; }
  @media (min-width: 768px) {
    html {
      font-size: 9.5px;
      line-height: 9.5px; } }
  @media (min-width: 850px) {
    html {
      font-size: 10px;
      line-height: 10px; } }

body, input, textarea, button {
  font-family: "ProximaNova", -apple-system, sans-serif;
  font-weight: 400;
  font-size: 1.7rem;
  line-height: 1.625; }

h1, h2, h3, h4, h5, h6 {
  margin: 0;
  color: #1c1c1c; }
  h1 i, h2 i, h3 i, h4 i, h5 i, h6 i {
    margin-right: 0.5em; }

h1, .h1 {
  font-weight: 300;
  font-size: 2.8rem;
  line-height: 3.2rem; }

h2, .h2 {
  font-weight: 300;
  font-size: 2.6rem;
  line-height: 3.1rem; }

h3, .h3 {
  font-weight: 300;
  font-size: 1.9rem;
  line-height: 2.2rem; }

h4, .h4 {
  font-weight: 300;
  font-size: 1.7rem;
  line-height: 1.8rem; }

h5, .h5 {
  font-weight: 300;
  font-size: 1.4rem;
  line-height: 1.8rem; }

h6, .h6 {
  font-weight: 300; }

p {
  margin: 1rem 0; }
  p:first-child {
    margin-top: 0; }
  p:last-child {
    margin-bottom: 0; }
  .headline + p {
    margin-top: .5rem; }

a {
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out;
  color: #faa21b;
  cursor: pointer; }
  a, a:hover {
    text-decoration: none; }

.accent {
  color: #939598; }

.accent-small {
  font-size: 1.5rem;
  line-height: 1.625;
  color: #939598; }

.disclaimer {
  font-size: 1.5rem;
  line-height: 1.625;
  color: #939598; }

.text-xsmall {
  font-size: 1.3rem;
  line-height: 1.625; }

small,
.text-small {
  font-size: 1.5rem;
  line-height: 1.625; }

.text-medium {
  font-size: 1.7rem;
  line-height: 1.625; }

.text-large {
  font-size: 1.9rem;
  line-height: 1.625; }

.text-condensed {
  display: block;
  line-height: 1.3; }

.text-left {
  text-align: left !important; }

.text-right {
  text-align: right !important; }

.text-center {
  text-align: center !important; }

.text-upper {
  text-transform: uppercase; }

.text-lower {
  text-transform: lowercase; }

.text-capitalize {
  text-transform: capitalize; }

.text-justify {
  text-align: justify; }

.text-bold {
  font-weight: 500; }

.text-caps {
  text-transform: uppercase; }

.text-light {
  color: #939598; }

.text-red {
  color: #da5450; }

.text-green {
  color: #bfd730; }

.text-new-orange {
  color: #f77e0d; }

.text-indented {
  text-indent: 2rem; }
  .text-indented * {
    text-indent: 0; }

.negative-indent {
  text-indent: -.75rem;
  padding-left: .75rem; }
  .negative-indent * {
    text-indent: 0; }

input[type="color"], input[type="date"], input[type="datetime"], input[type="datetime-local"], input[type="email"], input[type="month"], input[type="number"], input[type="password"], input[type="search"], input[type="tel"], input[type="text"], input[type="time"], input[type="url"], input[type="week"], textarea {
  display: block;
  width: 100%;
  border: 1px solid #e1e1e1;
  border-radius: 3px;
  padding: .75rem 1rem;
  box-sizing: border-box; }
  input[type="color"] ::-webkit-input-placeholder, input[type="date"] ::-webkit-input-placeholder, input[type="datetime"] ::-webkit-input-placeholder, input[type="datetime-local"] ::-webkit-input-placeholder, input[type="email"] ::-webkit-input-placeholder, input[type="month"] ::-webkit-input-placeholder, input[type="number"] ::-webkit-input-placeholder, input[type="password"] ::-webkit-input-placeholder, input[type="search"] ::-webkit-input-placeholder, input[type="tel"] ::-webkit-input-placeholder, input[type="text"] ::-webkit-input-placeholder, input[type="time"] ::-webkit-input-placeholder, input[type="url"] ::-webkit-input-placeholder, input[type="week"] ::-webkit-input-placeholder, textarea ::-webkit-input-placeholder {
    color: #939598; }
  input[type="color"] :-moz-placeholder, input[type="date"] :-moz-placeholder, input[type="datetime"] :-moz-placeholder, input[type="datetime-local"] :-moz-placeholder, input[type="email"] :-moz-placeholder, input[type="month"] :-moz-placeholder, input[type="number"] :-moz-placeholder, input[type="password"] :-moz-placeholder, input[type="search"] :-moz-placeholder, input[type="tel"] :-moz-placeholder, input[type="text"] :-moz-placeholder, input[type="time"] :-moz-placeholder, input[type="url"] :-moz-placeholder, input[type="week"] :-moz-placeholder, textarea :-moz-placeholder {
    color: #939598; }
  input[type="color"] ::-moz-placeholder, input[type="date"] ::-moz-placeholder, input[type="datetime"] ::-moz-placeholder, input[type="datetime-local"] ::-moz-placeholder, input[type="email"] ::-moz-placeholder, input[type="month"] ::-moz-placeholder, input[type="number"] ::-moz-placeholder, input[type="password"] ::-moz-placeholder, input[type="search"] ::-moz-placeholder, input[type="tel"] ::-moz-placeholder, input[type="text"] ::-moz-placeholder, input[type="time"] ::-moz-placeholder, input[type="url"] ::-moz-placeholder, input[type="week"] ::-moz-placeholder, textarea ::-moz-placeholder {
    color: #939598; }
  input[type="color"] :-ms-input-placeholder, input[type="date"] :-ms-input-placeholder, input[type="datetime"] :-ms-input-placeholder, input[type="datetime-local"] :-ms-input-placeholder, input[type="email"] :-ms-input-placeholder, input[type="month"] :-ms-input-placeholder, input[type="number"] :-ms-input-placeholder, input[type="password"] :-ms-input-placeholder, input[type="search"] :-ms-input-placeholder, input[type="tel"] :-ms-input-placeholder, input[type="text"] :-ms-input-placeholder, input[type="time"] :-ms-input-placeholder, input[type="url"] :-ms-input-placeholder, input[type="week"] :-ms-input-placeholder, textarea :-ms-input-placeholder {
    color: #939598; }

input[type="color"], input[type="date"], input[type="datetime"], input[type="datetime-local"], input[type="email"], input[type="month"], input[type="number"], input[type="password"], input[type="search"], input[type="tel"], input[type="text"], input[type="time"], input[type="url"], input[type="week"], textarea {
  -webkit-user-select: text;
  -moz-user-select: text;
  -ms-user-select: text;
  user-select: text; }

textarea[autosize] {
  resize: none !important;
  width: 100% !important;
  min-height: calc(1.5rem + 2em) !important;
  max-height: 240px;
  margin: 0 !important; }

textarea[autosize].no-redactor {
  min-height: 5em !important; }

.form__row + .form__row {
  margin-top: 2rem; }

.form__input {
  position: relative; }
  .form__input label {
    font-size: 1.7rem;
    line-height: 1.4;
    display: block;
    margin-bottom: 1rem;
    color: #1c1c1c; }
  .form__input .input {
    position: relative; }
  @media (min-width: 850px) {
    .form__input--horizontal {
      display: table;
      width: 100%; }
      .form__input--horizontal > label, .form__input--horizontal > input {
        display: table-cell;
        vertical-align: middle; }
      .form__input--horizontal > label {
        width: 180px;
        padding-right: 24px;
        text-align: right; }
        .form__input--horizontal > label.label--xsmall {
          width: 50px; }
        .form__input--horizontal > label.label--small {
          width: 75px; } }
  .form__input input[disabled] {
    background-color: whitesmoke; }

.form__checkbox + .form__checkbox, .form__radio + .form__checkbox, .form__checkbox + .form__radio, .form__radio + .form__radio {
  margin-top: .5rem; }

.form__checkbox label, .form__radio label {
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out;
  font-size: 1.5rem;
  line-height: 1.3;
  position: relative;
  display: block;
  padding-left: 2.5rem;
  color: #4b4a4b;
  position: relative; }
  .form__checkbox label > *, .form__radio label > * {
    pointer-events: none; }
  .form__checkbox label:before, .form__radio label:before {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: "";
    height: 1.5rem;
    width: 1.5rem;
    position: absolute;
    top: 0.2em;
    left: 0;
    display: block;
    border: 1px solid #4b4a4b;
    border-radius: 3px;
    color: rgba(28, 28, 28, 0);
    padding: .2rem;
    font-size: 1rem; }

.form__checkbox input, .form__radio input {
  position: absolute;
  opacity: 0; }
  .form__checkbox input:checked + label:before, .form__radio input:checked + label:before {
    color: #1c1c1c; }
  .form__checkbox input:checked + label:hover::before, .form__radio input:checked + label:hover::before {
    border-color: #faa21b; }
  .form__checkbox input[type="checkbox"]:focus + label::before, .form__radio input[type="checkbox"]:focus + label::before {
    outline: #3b99fc auto 5px; }

.form__checkbox small, .form__radio small {
  font-size: 1.3rem;
  line-height: 1.625;
  display: block;
  margin: .5rem 0;
  text-indent: 0; }

.form__checkbox img, .form__radio img {
  margin-top: 1rem; }

.form__checkbox--sub {
  position: relative;
  top: -2px;
  margin-left: 2rem; }
  .form__checkbox--sub label {
    color: #939598; }

.form__radio label:before {
  content: '';
  background: rgba(146, 175, 43, 0); }

.form__radio label:hover:before {
  border-color: #faa21b;
  background-clip: content-box; }

.form__radio label:focus::before, .form__radio label:hover::before {
  background-color: #92af2b;
  border-color: #faa21b; }

.form__radio input:checked + label:before {
  background-color: #92af2b;
  border-color: #4b4a4b; }
  @media print {
    .form__radio input:checked + label:before {
      background-color: #C0C3C7 !important;
      -webkit-print-color-adjust: exact; } }

.form__radio input:checked + label:hover::before {
  border-color: #faa21b; }

.form__radio input:enabled:checked:hover:before {
  border: 1px solid #faa21b; }

.form__radio input:disabled + label:before {
  border-color: #4b4a4b; }

.form__radio input:disabled + label li:hover:before {
  border-color: #4b4a4b; }

.form__helper {
  font-size: 1.5rem;
  line-height: 1.625;
  display: block;
  color: #939598; }

.form__submit {
  margin-top: 3rem !important;
  clear: both; }
  .form__submit::after {
    clear: both;
    content: "";
    display: table; }
  .form__submit--center {
    text-align: center; }
  .form__submit button {
    float: left; }
    .form__submit button:last-child {
      float: right; }

/* Angular Form Handling */
.selectize-input[required].ng-dirty.ng-valid:not([no-validation]),
input[type="color"][required].ng-dirty.ng-valid:not([no-validation]), input[type="date"][required].ng-dirty.ng-valid:not([no-validation]), input[type="datetime"][required].ng-dirty.ng-valid:not([no-validation]), input[type="datetime-local"][required].ng-dirty.ng-valid:not([no-validation]), input[type="email"][required].ng-dirty.ng-valid:not([no-validation]), input[type="month"][required].ng-dirty.ng-valid:not([no-validation]), input[type="number"][required].ng-dirty.ng-valid:not([no-validation]), input[type="password"][required].ng-dirty.ng-valid:not([no-validation]), input[type="search"][required].ng-dirty.ng-valid:not([no-validation]), input[type="tel"][required].ng-dirty.ng-valid:not([no-validation]), input[type="text"][required].ng-dirty.ng-valid:not([no-validation]), input[type="time"][required].ng-dirty.ng-valid:not([no-validation]), input[type="url"][required].ng-dirty.ng-valid:not([no-validation]), input[type="week"][required].ng-dirty.ng-valid:not([no-validation]), textarea[required].ng-dirty.ng-valid:not([no-validation]) {
  border-color: #bfd730; }
  .selectize-input[required].ng-dirty.ng-valid:not([no-validation]):focus,
  input[type="color"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="date"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="datetime"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="datetime-local"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="email"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="month"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="number"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="password"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="search"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="tel"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="text"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="time"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="url"][required].ng-dirty.ng-valid:not([no-validation]):focus, input[type="week"][required].ng-dirty.ng-valid:not([no-validation]):focus, textarea[required].ng-dirty.ng-valid:not([no-validation]):focus {
    border-color: #faa21b; }

.selectize-input[required].ng-dirty.ng-invalid,
input[type="color"][required].ng-dirty.ng-invalid, input[type="date"][required].ng-dirty.ng-invalid, input[type="datetime"][required].ng-dirty.ng-invalid, input[type="datetime-local"][required].ng-dirty.ng-invalid, input[type="email"][required].ng-dirty.ng-invalid, input[type="month"][required].ng-dirty.ng-invalid, input[type="number"][required].ng-dirty.ng-invalid, input[type="password"][required].ng-dirty.ng-invalid, input[type="search"][required].ng-dirty.ng-invalid, input[type="tel"][required].ng-dirty.ng-invalid, input[type="text"][required].ng-dirty.ng-invalid, input[type="time"][required].ng-dirty.ng-invalid, input[type="url"][required].ng-dirty.ng-invalid, input[type="week"][required].ng-dirty.ng-invalid, textarea[required].ng-dirty.ng-invalid {
  border-color: #da5450;
  background: rgba(218, 84, 80, 0.05); }

.ng-invalid [type='submit'] {
  opacity: .5; }

section {
  padding-top: 4rem;
  padding-bottom: 4rem; }

figure {
  margin: 0; }

img {
  max-width: 100%;
  height: auto; }
  img.round {
    border-radius: 50%; }
  p img {
    vertical-align: middle;
    margin-left: .5rem; }
    p img:first-child {
      margin-left: 0; }

fieldset {
  margin: 0;
  border: none;
  padding: 0; }
  fieldset[disabled='disabled'] {
    position: relative; }
    fieldset[disabled='disabled']:after {
      position: absolute;
      top: 0;
      right: 0;
      bottom: 0;
      left: 0;
      background: rgba(255, 255, 255, 0.7);
      z-index: 9;
      content: ''; }

audio {
  width: 100%; }

blockquote {
  margin: 0; }

mark {
  background: none; }

label {
  cursor: pointer; }
  label input {
    position: absolute;
    visibility: hidden;
    z-index: -1; }

ul.no-bullets, ol.no-bullets {
  list-style: none;
  padding-left: 0; }

ul.alpha, ol.alpha {
  list-style: upper-alpha; }

ul {
  padding-left: 3rem; }

ol {
  padding-left: 1.4em; }

li {
  margin-top: 8px; }
  li:first-child {
    margin-top: 0; }

svg {
  vertical-align: middle;
  position: relative;
  top: -1px; }

s * {
  text-decoration: line-through; }

* {
  box-sizing: border-box; }
  *:focus {
    outline: none !important; }

html {
  overflow-y: scroll;
  /* Needs to be set explicitly for Chrome app */ }
  html.state-overlay-open #main-app-div {
    position: fixed;
    top: 0;
    right: 0;
    bottom: 0;
    left: 0; }
    @media print {
      html.state-overlay-open #main-app-div {
        top: 0 !important;
        /* Override top style applied to disable parent frame scrolling */ } }

body {
  min-width: 320px;
  background: #ffffff; }
  body:before {
    -webkit-transition: background 1s ease-in-out;
    -moz-transition: background 1s ease-in-out;
    transition: background 1s ease-in-out;
    position: fixed;
    top: 0;
    left: 0;
    height: 100%;
    width: 100%;
    background: rgba(255, 255, 255, 0);
    content: '';
    z-index: -1; }
    @media print {
      body:before {
        display: none; } }
  body.nav-open, body.fullscreen-enabled {
    overflow: hidden;
    height: 100vh; }
  body.fullscreen-enabled:before {
    background: white;
    z-index: 9998; }
  body.state-change [ui-view=main] {
    opacity: 0.5; }

/* Wrapper */
html[runtime=native] .upper-wrapper {
  z-index: 1000; }

@media (max-width: 767px) {
  .upper-wrapper {
    z-index: 1000; } }

.wrapper {
  margin-right: auto;
  margin-left: auto;
  position: relative; }
  html[runtime=native] .wrapper {
    margin-top: 1em; }
    @media (max-width: 767px) {
      html[runtime=native] .wrapper {
        margin-top: 9rem; }
        html[runtime=native] html[runtime=native] .wrapper {
          margin-top: 5.5rem; } }
    .hide-subnav-on-mobile html[runtime=native] .wrapper {
      margin-top: 5.5rem; }
  @media (max-width: 767px) {
    .wrapper {
      margin-top: 1em; } }
  @media (max-width: 767px) and (max-width: 767px) {
    .wrapper {
      margin-top: 9rem; }
      html[runtime=native] .wrapper {
        margin-top: 5.5rem; } }
  @media (max-width: 767px) {
      .hide-subnav-on-mobile .wrapper {
        margin-top: 5.5rem; } }
  @media only screen {
    .wrapper {
      min-height: 100vh; } }
  .nav-open .wrapper {
    -webkit-user-select: none;
    -webkit-user-drag: none; }
  .wrapper--plain {
    background: none;
    box-shadow: none; }

.load-wrapper {
  position: fixed;
  top: 0;
  right: 0;
  bottom: 0;
  left: 0;
  height: 100%;
  width: 100%;
  background: rgba(255, 255, 255, 0.25);
  z-index: 10000; }

/* Header */
#header {
  height: 5.5rem;
  background: #ffffff;
  text-align: center;
  position: relative;
  z-index: 101;
  /* Subscription */ }
  #header::after {
    clear: both;
    content: "";
    display: table; }
  html[runtime=native] #header {
    position: fixed;
    top: 0rem;
    left: 0;
    width: 100%;
    z-index: 999;
    border-bottom: 1px solid #e1e2e3; }
  @media (max-width: 767px) {
    #header {
      position: fixed;
      top: 0rem;
      left: 0;
      width: 100%;
      z-index: 999;
      border-bottom: 1px solid #e1e2e3; } }
  @media (min-width: 768px) {
    html[runtime=web] #header {
      height: 7.5rem; } }
  #header .container {
    height: 100%; }
  html[runtime=native] #header .primary-nav, html[runtime=native]
  #header .secondary-nav {
    display: none; }
  @media (max-width: 767px) {
    #header .primary-nav,
    #header .secondary-nav {
      display: none; } }
  #header .logo {
    padding: 1rem 0;
    height: 100%;
    margin-right: 2rem; }
    @media (min-width: 768px) {
      #header .logo img {
        width: 14rem; } }
    @media (min-width: 850px) {
      #header .logo img {
        width: 19rem; } }
    @media (min-width: 1150px) {
      #header .logo img {
        width: 23rem; } }
    @media (min-width: 768px) {
      #header .logo {
        padding: 3.5rem 0 2rem; } }
    @media (min-width: 850px) {
      #header .logo {
        padding: 2.7rem 0 1.5rem; } }
    @media (min-width: 1150px) {
      #header .logo {
        padding: 2.2rem 0; } }
    @media print {
      #header .logo {
        display: block;
        text-align: center;
        float: none;
        padding-top: 2rem; } }
    html[runtime=native] #header .logo {
      -webkit-transform: translateY(-50%) translateX(-50%);
      -moz-transform: translateY(-50%) translateX(-50%);
      -ms-transform: translateY(-50%) translateX(-50%);
      -o-transform: translateY(-50%) translateX(-50%);
      transform: translateY(-50%) translateX(-50%);
      padding: 1rem 0;
      position: absolute;
      top: 50%;
      left: 50%; }
      html[runtime=native] #header .logo img {
        width: 19rem !important; }
    @media (max-width: 767px) {
      #header .logo {
        -webkit-transform: translateY(-50%) translateX(-50%);
        -moz-transform: translateY(-50%) translateX(-50%);
        -ms-transform: translateY(-50%) translateX(-50%);
        -o-transform: translateY(-50%) translateX(-50%);
        transform: translateY(-50%) translateX(-50%);
        padding: 1rem 0;
        position: absolute;
        top: 50%;
        left: 50%; }
        #header .logo img {
          width: 19rem !important; } }
    @media (min-width: 768px) {
      html[runtime=web] #header .logo {
        float: left; } }
  #header .subscription {
    position: absolute;
    top: 15px;
    right: 2.5%;
    font-size: 1.5rem;
    line-height: 1.625;
    display: none;
    color: #939598; }
    @media (min-width: 850px) {
      #header .subscription {
        overflow: hidden;
        text-overflow: ellipsis;
        white-space: nowrap;
        display: block;
        max-width: 15%; } }
    @media (min-width: 1150px) {
      #header .subscription {
        display: block;
        max-width: none; } }
    #header .subscription:before {
      font-size: 1.3rem;
      line-height: 1.625;
      -webkit-transition: none;
      -moz-transition: none;
      transition: none;
      padding-right: .5rem; }
    #header .subscription:hover {
      color: #faa21b; }

/* Logo */
.logo img {
  display: block;
  padding: 0; }
  @media print {
    .logo img {
      margin: 0 auto; } }

.logo.centered img {
  margin: 0 auto; }

/* Nav Toggle */
.nav-toggle {
  margin: 0;
  padding: 0;
  list-style: none;
  -webkit-transform: translateY(-50%);
  -moz-transform: translateY(-50%);
  -ms-transform: translateY(-50%);
  -o-transform: translateY(-50%);
  transform: translateY(-50%);
  position: absolute;
  top: 50%;
  width: 49px;
  padding: 12px;
  right: 2.5rem;
  margin-right: -12px;
  cursor: pointer;
  z-index: 100; }
  .nav-toggle::after {
    clear: both;
    content: "";
    display: table; }
  .nav-toggle > li, .nav-toggle > dd {
    margin: 0; }
  @media print {
    .nav-toggle {
      display: none; } }
  @media (min-width: 768px) {
    html[runtime=web] .nav-toggle {
      display: none; } }
  .nav-toggle li {
    -webkit-transition: all 0.5s ease-in-out;
    -moz-transition: all 0.5s ease-in-out;
    transition: all 0.5s ease-in-out;
    -webkit-transform-origin: 50% 50%;
    -moz-transform-origin: 50% 50%;
    -ms-transform-origin: 50% 50%;
    -o-transform-origin: 50% 50%;
    transform-origin: 50% 50%;
    display: block;
    height: 3px;
    background-color: #181718; }
  .nav-toggle li + li {
    margin-top: 4px; }
  .nav-toggle.active li:nth-child(2) {
    opacity: 0; }
  .nav-toggle.active li:first-child {
    -webkit-transform: rotate3d(0, 0, 1, 45deg) translate3d(5px, 5px, 0);
    -moz-transform: rotate3d(0, 0, 1, 45deg) translate3d(5px, 5px, 0);
    -ms-transform: rotate3d(0, 0, 1, 45deg) translate3d(5px, 5px, 0);
    -o-transform: rotate3d(0, 0, 1, 45deg) translate3d(5px, 5px, 0);
    transform: rotate3d(0, 0, 1, 45deg) translate3d(5px, 5px, 0); }
  .nav-toggle.active li:last-child {
    -webkit-transform: rotate3d(0, 0, 1, -45deg) translate3d(5px, -5px, 0);
    -moz-transform: rotate3d(0, 0, 1, -45deg) translate3d(5px, -5px, 0);
    -ms-transform: rotate3d(0, 0, 1, -45deg) translate3d(5px, -5px, 0);
    -o-transform: rotate3d(0, 0, 1, -45deg) translate3d(5px, -5px, 0);
    transform: rotate3d(0, 0, 1, -45deg) translate3d(5px, -5px, 0); }

/* Status Indicator */
.nav-status, .nav-help {
  -webkit-transform: translateY(-50%);
  -moz-transform: translateY(-50%);
  -ms-transform: translateY(-50%);
  -o-transform: translateY(-50%);
  transform: translateY(-50%);
  position: absolute;
  top: 50%;
  display: none;
  width: 49px;
  padding: 12px;
  cursor: pointer;
  z-index: 100; }
  @media print {
    .nav-status, .nav-help {
      display: none; } }
  html[runtime=native] .nav-status, html[runtime=native] .nav-help {
    display: block; }
  .nav-status::before, .nav-help::before {
    font-size: 200%; }

.nav-help {
  right: 2.5rem;
  margin-right: -12px; }

.nav-status {
  left: 2.5rem;
  margin-left: -12px; }
  .nav-status.sync-status-ready {
    color: #92af2b; }
  .nav-status.sync-status-offline {
    color: #faa21b; }
  .nav-status.sync-status-downloading {
    color: #faa21b; }
  .nav-status.sync-status-dirty {
    color: #da5450 !important; }

/* Primary Nav */
.primary-nav,
.overlay-nav {
  margin: 0;
  padding: 0;
  list-style: none;
  height: 100%;
  float: left; }
  .primary-nav::after,
  .overlay-nav::after {
    clear: both;
    content: "";
    display: table; }
  .primary-nav > li, .primary-nav > dd,
  .overlay-nav > li,
  .overlay-nav > dd {
    margin: 0; }
  @media print {
    .primary-nav,
    .overlay-nav {
      display: none; } }
  .primary-nav.help-center,
  .overlay-nav.help-center {
    float: right; }
    .primary-nav.help-center a,
    .overlay-nav.help-center a {
      font-size: 1.6rem;
      font-family: "ProximaNova", -apple-system, sans-serif;
      font-weight: 400;
      text-transform: inherit;
      color: #faa21b; }
  .primary-nav li,
  .overlay-nav li {
    height: 100%;
    position: relative;
    float: left; }
  .primary-nav a,
  .overlay-nav a {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    font-size: 14px;
    line-height: 1em;
    padding: 4rem 2rem 1.7rem;
    top: 46%;
    color: #939598;
    position: relative;
    text-transform: uppercase;
    font-weight: 600; }
    html[runtime=native] .primary-nav a, html[runtime=native]
    .overlay-nav a {
      color: #4b4a4b; }
    @media (max-width: 767px) {
      .primary-nav a,
      .overlay-nav a {
        color: #4b4a4b; } }
    @media (min-width: 1150px) {
      .primary-nav a,
      .overlay-nav a {
        font-size: 1.7rem; } }
    .primary-nav a:before,
    .overlay-nav a:before {
      font-size: 24px;
      margin-right: 12px;
      width: 24px; }
      @media (min-width: 0) {
        .primary-nav a:before,
        .overlay-nav a:before {
          font-size: 20px;
          line-height: 1em;
          width: 20px; } }
      @media (min-width: 768px) {
        html[runtime=web] .primary-nav a:before, html[runtime=web]
        .overlay-nav a:before {
          display: none; } }
    .primary-nav a:after,
    .overlay-nav a:after {
      position: absolute;
      right: 0;
      bottom: 0;
      left: 50%;
      height: 0;
      width: 0;
      border-bottom: 1rem solid #939598;
      border-left: 1rem solid transparent;
      border-right: 1rem solid transparent;
      content: '';
      opacity: 0;
      margin-left: -1rem; }
  @media (min-width: 768px) {
    html[runtime=web] .primary-nav .active a:after, html[runtime=web]
    .overlay-nav .active a:after {
      opacity: 1; } }
  .primary-nav:hover > a,
  .overlay-nav:hover > a {
    color: #4b4a4b; }
  .primary-nav .active,
  .primary-nav .active > a,
  .overlay-nav .active,
  .overlay-nav .active > a {
    color: #faa21b; }
  .primary-nav .primary__notification,
  .overlay-nav .primary__notification {
    font-size: 1rem;
    line-height: 1.7rem;
    height: 1.7rem;
    width: 1.7rem;
    position: absolute;
    top: auto;
    right: 8px;
    bottom: 35px;
    left: auto;
    background: #faa21b;
    border-radius: 50%;
    color: #ffffff;
    text-align: center;
    font-weight: 900; }
    @media (min-width: 850px) {
      .primary-nav .primary__notification,
      .overlay-nav .primary__notification {
        padding-top: 1px;
        padding-left: 1px; } }
    .primary-nav .primary__notification--warning,
    .overlay-nav .primary__notification--warning {
      background: #da5450; }
    @media (max-width: 767px) {
      .primary-nav .primary__notification,
      .overlay-nav .primary__notification {
        display: none; } }

/* Secondary Nav */
.secondary-nav {
  font-size: 1.5rem;
  line-height: 1.625;
  text-align: left; }
  .secondary-nav, .secondary-nav ul {
    margin: 0;
    padding: 0;
    list-style: none; }
    .secondary-nav::after, .secondary-nav ul::after {
      clear: both;
      content: "";
      display: table; }
    .secondary-nav > li, .secondary-nav > dd, .secondary-nav ul > li, .secondary-nav ul > dd {
      margin: 0; }
  @media print {
    .secondary-nav {
      display: none; } }
  @media (min-width: 768px) {
    html[runtime=web] .secondary-nav {
      float: right; } }
  .secondary-nav li {
    position: relative; }
  .secondary-nav a {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    color: #4b4a4b; }
    .secondary-nav a:before {
      min-width: 1.5em; }
  .secondary-nav .secondary__alert {
    -webkit-transition: color 0.15s ease-in-out;
    -moz-transition: color 0.15s ease-in-out;
    transition: color 0.15s ease-in-out;
    position: absolute;
    top: 0.5rem;
    -webkit-transform: translate(-150%);
    -moz-transform: translate(-150%);
    -ms-transform: translate(-150%);
    -o-transform: translate(-150%);
    transform: translate(-150%);
    color: #faa21b;
    text-align: center;
    border-radius: 50%; }
    .secondary-nav .secondary__alert::before {
      -webkit-transition: color 0.15s ease-in-out;
      -moz-transition: color 0.15s ease-in-out;
      transition: color 0.15s ease-in-out;
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      margin-right: .5rem;
      min-width: inherit; }
    .secondary-nav .secondary__alert:hover, .secondary-nav .secondary__alert:focus {
      color: #f77e0d; }
  .secondary-nav .secondary__name {
    position: relative;
    font-size: 1.5rem;
    line-height: 1em;
    margin: 3.1rem 0 0;
    padding: 1rem 2.5rem 1rem 0;
    display: none;
    font-style: italic; }
    @media (min-width: 768px) {
      .secondary-nav .secondary__name {
        overflow: hidden;
        text-overflow: ellipsis;
        white-space: nowrap;
        display: block;
        max-width: 11rem; } }
    @media (min-width: 960px) {
      .secondary-nav .secondary__name {
        max-width: 20rem; } }
    .secondary-nav .secondary__name:after {
      position: absolute;
      top: 1rem;
      right: 1rem;
      font-family: "ss-icons";
      content: "";
      font-size: 5px; }
  .secondary-nav .secondary__drop-nav {
    -webkit-transition: opacity 0.3s ease-in-out, -webkit-transform 0.3s ease-in-out;
    -moz-transition: opacity 0.3s ease-in-out, -moz-transform 0.3s ease-in-out;
    transition: opacity 0.3s ease-in-out, transform 0.3s ease-in-out;
    position: absolute;
    top: 100%;
    right: -19px;
    background: #ffffff;
    border: 1px solid #e1e1e1;
    z-index: -1;
    box-shadow: 0 0 5px 0 rgba(225, 225, 225, 0.8); }
    @media (max-width: 767px) {
      .secondary-nav .secondary__drop-nav {
        display: inherit !important; } }
    .secondary-nav .secondary__drop-nav > li {
      padding: 1.25rem; }
    .secondary-nav .secondary__drop-nav:before {
      position: absolute;
      top: -10px;
      right: 10px;
      height: 2.2rem;
      width: 2.2rem;
      -webkit-transform: rotate(-45deg) translateY(-1px);
      -moz-transform: rotate(-45deg) translateY(-1px);
      -ms-transform: rotate(-45deg) translateY(-1px);
      -o-transform: rotate(-45deg) translateY(-1px);
      transform: rotate(-45deg) translateY(-1px);
      content: '';
      background: #ffffff;
      border: 1px solid;
      border-color: #e1e1e1 #e1e1e1 #ffffff #ffffff; }
    .secondary-nav .secondary__drop-nav.ng-enter, .secondary-nav .secondary__drop-nav.ng-leave.ng-leave-active {
      -webkit-transform: translateY(-5px);
      -moz-transform: translateY(-5px);
      -ms-transform: translateY(-5px);
      -o-transform: translateY(-5px);
      transform: translateY(-5px);
      opacity: 0; }
    .secondary-nav .secondary__drop-nav.ng-leave, .secondary-nav .secondary__drop-nav.ng-enter.ng-enter-active {
      -webkit-transform: translateY(0);
      -moz-transform: translateY(0);
      -ms-transform: translateY(0);
      -o-transform: translateY(0);
      transform: translateY(0);
      opacity: 1;
      z-index: 902; }
  .secondary-nav .secondary__upper {
    white-space: nowrap; }
    .secondary-nav .secondary__upper li {
      display: inline-block; }
    .secondary-nav .secondary__upper li + li {
      margin-left: 1.4rem; }
    @media (min-width: 768px) {
      .secondary-nav .secondary__upper a {
        font-size: 1.6rem;
        line-height: 3.4rem;
        background-color: #fdb913;
        background-image: -webkit-linear-gradient(#fdb913, #faa21b);
        background-image: linear-gradient(#fdb913, #faa21b);
        display: inline-block;
        height: 3.4rem;
        padding: 0 23px;
        color: #ffffff !important;
        text-transform: none;
        border: none;
        vertical-align: middle;
        font-weight: 400;
        border-radius: .5rem;
        position: relative;
        /* Colors */
        background: transparent;
        border: 1px solid rgba(147, 149, 152, 0.5);
        color: #939598 !important;
        /* Size */
        font-size: 1.5rem;
        /* Icon */
        /* Mouse Actions */
        padding-right: 1.4rem;
        padding-left: 1.4rem; }
        .secondary-nav .secondary__upper a[disabled] {
          opacity: .5; }
        .secondary-nav .secondary__upper a.loading {
          opacity: 1;
          color: rgba(255, 255, 255, 0) !important; }
        .secondary-nav .secondary__upper a[class*='icon']:before {
          margin-right: .5rem; }
        .secondary-nav .secondary__upper a:active {
          top: 1px; } }
  .secondary-nav .secondary__lower {
    border-top: 1px solid #e1e1e1;
    display: block;
    padding: .5rem 0;
    font-weight: 600; }
    @media (min-width: 768px) {
      .secondary-nav .secondary__lower {
        border-top-width: 2px; } }
    @media (max-width: 767px) {
      .secondary-nav .secondary__lower a {
        font-size: 16px; } }

.droppable-secondary-nav .secondary__alert, .overlay-nav.navOpen .secondary__alert {
  position: absolute;
  top: 50%;
  right: 2rem;
  -webkit-transform: translateY(-50%);
  -moz-transform: translateY(-50%);
  -ms-transform: translateY(-50%);
  -o-transform: translateY(-50%);
  transform: translateY(-50%);
  height: 2rem;
  width: 2rem;
  padding: 0;
  color: #ffffff;
  text-align: center;
  line-height: 1.5; }
  .droppable-secondary-nav .secondary__alert::before, .overlay-nav.navOpen .secondary__alert::before {
    -webkit-transition: background 0.15s ease-in-out;
    -moz-transition: background 0.15s ease-in-out;
    transition: background 0.15s ease-in-out;
    position: absolute;
    top: 0;
    right: 0;
    height: 2rem;
    width: 2rem;
    display: block;
    content: '';
    margin: 0;
    background: #faa21b;
    border-radius: 50%;
    z-index: -1; }

.droppable-overlay.droppable-secondary-nav:before {
  left: auto;
  right: 1.5rem; }

/* Overlay Nav */
.overlay-nav.navOpen {
  font-size: 17px;
  line-height: 1em;
  -webkit-animation-name: slideInRight;
  -moz-animation-name: slideInRight;
  animation-name: slideInRight;
  -webkit-animation-delay: 0;
  -moz-animation-delay: 0;
  animation-delay: 0;
  -webkit-animation-duration: 500ms;
  -moz-animation-duration: 500ms;
  animation-duration: 500ms;
  -webkit-animation-fill-mode: both;
  -moz-animation-fill-mode: both;
  animation-fill-mode: both;
  position: fixed;
  top: 45px;
  right: 0;
  height: calc(100vh - 12px);
  width: 260px;
  padding: 30px 20px 0;
  background: #f5f5f5;
  overflow: hidden;
  z-index: 998;
  box-shadow: 0px 2px 14px 0px rgba(0, 0, 0, 0.3); }
  @media (max-width: 767px) {
    .overlay-nav.navOpen {
      overflow-y: scroll; } }
  .overlay-nav.navOpen.ng-leave {
    -webkit-animation-name: slideOutRight;
    -moz-animation-name: slideOutRight;
    animation-name: slideOutRight;
    -webkit-animation-delay: 0;
    -moz-animation-delay: 0;
    animation-delay: 0;
    -webkit-animation-duration: 500ms;
    -moz-animation-duration: 500ms;
    animation-duration: 500ms;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both; }
  .overlay-nav.navOpen .primary-nav {
    height: initial; }
  .overlay-nav.navOpen .onav__user {
    text-align: center;
    color: #1c1c1c; }
  .overlay-nav.navOpen .onav__assignment {
    position: absolute;
    top: auto;
    right: 0px;
    bottom: 0px;
    left: 0px;
    font-size: 14px;
    color: #1c1c1c; }
    @media screen and (max-height: 734px) {
      .overlay-nav.navOpen .onav__assignment {
        display: none; } }
    .overlay-nav.navOpen .onav__assignment img {
      display: block; }
    .overlay-nav.navOpen .onav__assignment-meta {
      margin: 0;
      padding: 0;
      list-style: none;
      background: #ffffff;
      padding: 15px; }
      .overlay-nav.navOpen .onav__assignment-meta::after {
        clear: both;
        content: "";
        display: table; }
      .overlay-nav.navOpen .onav__assignment-meta > li, .overlay-nav.navOpen .onav__assignment-meta > dd {
        margin: 0; }
    .overlay-nav.navOpen .onav__assignment li {
      overflow: hidden;
      text-overflow: ellipsis;
      white-space: nowrap;
      display: block;
      float: left;
      width: 45%; }
      .overlay-nav.navOpen .onav__assignment li:last-child {
        float: right; }
    .overlay-nav.navOpen .onav__assignment strong {
      display: block;
      color: #939598;
      font-weight: 400; }
  .overlay-nav.navOpen .logo {
    display: none;
    padding: 0;
    margin-bottom: 15px; }
    .overlay-nav.navOpen .logo img {
      margin: 0 auto;
      width: 180px; }
  @media (min-width: 768px) {
    html[runtime=web] .overlay-nav.navOpen ul + ul {
      border-top: 1px solid #e1e1e1;
      padding-top: 12px; } }
  .overlay-nav.navOpen li {
    padding: 1.5rem 0; }
  .overlay-nav.navOpen .card li + li {
    border-top: 0; }
  .overlay-nav.navOpen > ul {
    margin: 0;
    padding: 0;
    list-style: none;
    margin: 12px 0; }
    .overlay-nav.navOpen > ul::after {
      clear: both;
      content: "";
      display: table; }
    .overlay-nav.navOpen > ul > li, .overlay-nav.navOpen > ul > dd {
      margin: 0; }
    .overlay-nav.navOpen > ul > li, .overlay-nav.navOpen > ul ng-include > li {
      clear: both; }
  .overlay-nav.navOpen a {
    padding: 12px 0; }
  .overlay-nav.navOpen__close {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    position: absolute;
    right: 2.5rem;
    top: 15px;
    font-size: 35px;
    font-weight: bold; }
  .overlay-nav.navOpen__assignments li {
    background: #ffffff;
    border-bottom: 1px solid #e1e1e1; }
  .overlay-nav.navOpen__assignments a {
    line-height: 1.5em; }
    .overlay-nav.navOpen__assignments a:before {
      margin-right: 1rem; }
  .overlay-nav.navOpen__assignments .assignments__thumb img {
    display: block;
    padding: 0; }
  .overlay-nav.navOpen .current-overlay {
    position: fixed;
    bottom: 40px;
    right: 0;
    width: 260px; }
  .overlay-nav.navOpen .secondary__alert {
    right: -3rem; }

/* Main Body */
main {
  padding-top: 2.5rem; }
  @media (min-width: 768px) {
    main--border {
      border: solid #e1e1e1;
      border-width: 0 1px; } }
  main.embed-mode {
    padding: 0; }

@media print {
  .ngdialog-open [ui-view="app"] {
    display: none; } }

@media (min-width: 768px) {
  .show-for-small {
    display: none !important; } }

@media (max-width: 767px) {
  .hide-for-small {
    display: none !important; } }

@media (min-width: 850px) {
  .hide-for-large {
    display: none !important; } }

@media (max-width: 1149px) {
  .show-for-xlarge {
    display: none !important; } }

@media only screen {
  .show-for-print {
    display: none !important; } }

@media print {
  [ng-show][show-for-print]:not(.ng-animate) {
    display: block !important; } }

@media print {
  .hide-for-print {
    display: none !important; } }

@media print {
  .print-avoid-breaks {
    -webkit-column-break-inside: avoid;
    page-break-inside: avoid;
    break-inside: avoid;
    margin-bottom: 3rem; } }

.hidden {
  position: absolute;
  left: -10000px;
  top: auto;
  width: 1px;
  height: 1px;
  overflow: hidden; }

.hide-label {
  float: right;
  color: transparent;
  height: 0;
  width: 0; }

@media (min-width: 768px) {
  .binder__year.headline--strikethrough::before {
    width: 90%; } }

.binder__year.headline--strikethrough .toggle-view {
  top: 0; }

@media (min-width: 768px) {
  .binder__year.headline-select--strikethrough::before {
    margin-left: 10%;
    width: 80%; } }

@media (min-width: 768px) {
  .binder__year.headline-select--strikethrough .select-all {
    position: absolute;
    top: 0;
    left: 0; } }

.binder__selected {
  margin-bottom: 1em; }

.binder__export {
  margin-top: 2em; }

.binder .card-listings {
  margin-top: 0; }
  .binder .card-listings .assignment .card__body {
    padding-bottom: 1.5rem; }
  .binder .card-listings .assignment .assignment__icon {
    top: 1.5rem;
    bottom: auto; }

[a-href] {
  cursor: pointer; }

.accordion {
  /* Pane */
  /* Header */
  /* Content */
  /* Editable */ }
  .accordion v-pane {
    overflow: hidden;
    border-bottom: 1px solid #e1e1e1; }
    .accordion v-pane.compare {
      border-top: 1px dashed #00abe6;
      border-right: 1px dashed #00abe6;
      border-left: 1px dashed #00abe6; }
      .accordion v-pane.compare + .compare {
        border-top: none; }
      .accordion v-pane.compare + :not(.compare) {
        border-top: 1px dashed #00abe6; }
      .accordion v-pane.compare__divider {
        border-top: 1px dashed #00abe6 !important; }
      .accordion v-pane.compare .section__name, .accordion v-pane.compare .section__description {
        padding-left: 2.5rem; }
  .accordion v-pane-header {
    padding: 3rem 8rem 3rem 0; }
    .accordion v-pane-header:after {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      height: 2rem;
      width: 2rem;
      -webkit-transform: translateY(-50%);
      -moz-transform: translateY(-50%);
      -ms-transform: translateY(-50%);
      -o-transform: translateY(-50%);
      transform: translateY(-50%);
      position: absolute;
      top: 50%;
      right: 3rem;
      background: #f77e0d;
      border-radius: 50%;
      text-align: center;
      line-height: 2rem;
      color: #ffffff;
      padding-left: .15em;
      padding-top: .05em; }
    .accordion v-pane-header .section__name {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      display: inline-block; }
    .accordion v-pane-header .section__type icon {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      color: #00abe6;
      padding-left: 1rem; }
  .accordion .is-expanded > v-pane-header:after {
    -webkit-transform: rotate(90deg);
    -moz-transform: rotate(90deg);
    -ms-transform: rotate(90deg);
    -o-transform: rotate(90deg);
    transform: rotate(90deg);
    margin-top: -1rem; }
  .accordion v-pane-content .file-list {
    margin-bottom: 3rem; }
  .accordion v-pane-content .section__description {
    margin-bottom: 2rem; }
  .accordion .is-expanded > v-pane-content {
    margin-bottom: 3rem; }
  .accordion .inline-form-editable v-pane-header {
    position: relative;
    padding: 3rem 8rem 3rem 5rem; }
    @media (min-width: 768px) {
      .accordion .inline-form-editable v-pane-header {
        padding: 3rem 8rem 3rem 0; } }
    .accordion .inline-form-editable v-pane-header .editable-draggable {
      padding: 2.5rem 2rem; }
    .accordion .inline-form-editable v-pane-header .section__name {
      margin-bottom: 2rem; }
      @media (min-width: 768px) {
        .accordion .inline-form-editable v-pane-header .section__name {
          width: 52%;
          margin-right: 5rem;
          margin-bottom: 0;
          margin-left: 4.5rem; } }
      @media (min-width: 1150px) {
        .accordion .inline-form-editable v-pane-header .section__name {
          width: 64%; } }
      .accordion .inline-form-editable v-pane-header .section__name input {
        font-size: 1.9rem;
        font-weight: 300;
        height: 2.2rem; }
    @media (min-width: 768px) {
      .accordion .inline-form-editable v-pane-header .section__delete {
        position: absolute;
        top: 2.3rem;
        right: 7rem; } }
  .accordion .inline-form-editable v-pane-content .editable-add {
    margin-left: 5rem; }
    @media (min-width: 768px) {
      .accordion .inline-form-editable v-pane-content .editable-add {
        margin-left: 3rem; } }

@-webkit-keyframes spin {
  from {
    -webkit-transform: rotate(0deg); }
  to {
    -webkit-transform: rotate(360deg); } }

@-moz-keyframes spin {
  from {
    -moz-transform: rotate(0deg); }
  to {
    -moz-transform: rotate(360deg); } }

@keyframes spin {
  from {
    -webkit-transform: rotate(0deg);
    -moz-transform: rotate(0deg);
    -ms-transform: rotate(0deg);
    -o-transform: rotate(0deg);
    transform: rotate(0deg); }
  to {
    -webkit-transform: rotate(360deg);
    -moz-transform: rotate(360deg);
    -ms-transform: rotate(360deg);
    -o-transform: rotate(360deg);
    transform: rotate(360deg); } }

.animation--spin {
  -webkit-animation: spin 1s linear;
  -moz-animation: spin 1s linear;
  animation: spin 1s linear; }

.assignment-wrap-container {
  position: relative; }

.assignment-wrap {
  position: absolute;
  top: 0;
  right: auto;
  bottom: 0;
  left: 0;
  width: 100%;
  max-width: 0;
  border-left: 6px solid #00abe6;
  z-index: 100; }
  @media print {
    .assignment-wrap {
      display: none; } }
  .assignment-wrap.active {
    position: absolute;
    top: 0;
    right: 0;
    bottom: 0;
    left: 46%;
    border-color: #faa21b; }
    .assignment-wrap.active .wrap__toggle {
      left: calc(46% - 47px); }
    .assignment-wrap.active .wrap__content {
      left: 0px; }
  .assignment-wrap .wrap__toggle {
    font-size: 1.6rem;
    line-height: 3.4rem;
    background-color: #fdb913;
    background-image: -webkit-linear-gradient(#fdb913, #faa21b);
    background-image: linear-gradient(#fdb913, #faa21b);
    display: inline-block;
    height: 3.4rem;
    padding: 0 23px;
    color: #ffffff !important;
    text-transform: none;
    border: none;
    vertical-align: middle;
    font-weight: 400;
    border-radius: .5rem;
    position: relative;
    /* Colors */
    /* Size */
    /* Icon */
    /* Mouse Actions */
    -webkit-transform: rotate(-90deg);
    -moz-transform: rotate(-90deg);
    -ms-transform: rotate(-90deg);
    -o-transform: rotate(-90deg);
    transform: rotate(-90deg);
    border-top-left-radius: 0;
    border-top-right-radius: 0;
    position: fixed;
    top: 0;
    right: auto;
    bottom: auto;
    left: -50px;
    width: 140px;
    background: #00abe6;
    white-space: nowrap; }
    .assignment-wrap .wrap__toggle[disabled] {
      opacity: .5; }
    .assignment-wrap .wrap__toggle.loading {
      opacity: 1;
      color: rgba(255, 255, 255, 0) !important; }
    .assignment-wrap .wrap__toggle[class*='icon']:before {
      margin-right: .5rem; }
    .assignment-wrap .wrap__toggle i {
      opacity: .5;
      margin-left: .5rem; }
    .assignment-wrap .wrap__toggle-icon:before {
      transform: rotate(90deg); }
    @media (max-width: 767px) {
      .assignment-wrap .wrap__toggle-name {
        display: none; } }
    .assignment-wrap .wrap__toggle.active {
      background: #faa21b; }
  .assignment-wrap .wrap__content {
    z-index: 200;
    position: fixed;
    height: 400px;
    overflow-y: auto;
    width: 46%;
    padding-left: 32px;
    padding-top: 16px;
    padding-right: 16px;
    background-color: white;
    left: -46%; }
  @media (max-width: 767px) {
    .assignment-wrap .wrap__content {
      width: 90%;
      left: -90%; }
    .assignment-wrap .wrap__toggle {
      position: fixed;
      top: 0;
      right: auto;
      bottom: auto;
      left: -20px;
      width: 72px; }
    .assignment-wrap.active {
      position: absolute;
      top: 0;
      right: 0;
      bottom: 0;
      left: 90%; }
      .assignment-wrap.active .wrap__toggle {
        left: calc(90% - 1.9rem); } }

.assignment {
  /* Within Card Listings */
  /* Full Width */ }
  .assignment-blast {
    margin-top: -2.5rem; }
  .assignment__header {
    padding-top: 2rem;
    padding-bottom: 2rem;
    background: #f5f5f5;
    border-bottom: 1px solid #e1e1e1;
    min-height: 8rem;
    margin-top: -2.5rem;
    padding-top: 0;
    padding-bottom: 1.5rem; }
    .overlay .assignment__header, .assignment__header.previewMode, .embed-mode .assignment__header {
      margin-top: 0; }
    @media only screen and (min-width: 768px) and (min-height: 800px) {
      .assignment__header.stuck {
        margin: 0; } }
  .assignment__body {
    padding-top: 0;
    padding-bottom: 2rem; }
    @media (min-width: 768px) {
      .assignment__body {
        min-height: calc(100vh - 129px); } }
    @media (min-width: 850px) {
      .assignment__body {
        min-height: calc(100vh - 136px); } }
    .assignment__body .research-links a {
      font-weight: 600; }
    .assignment__body table {
      width: auto !important; }
      .assignment__body table[width="100%"] {
        width: 100% !important; }
    .assignment__body .review__summary .summary__revision {
      display: block; }
    .assignment__body .review__summary i.icon-attention {
      color: #faa21b; }
  @media (max-width: 767px) {
    .assignment > .sticky-wrapper {
      height: auto !important; } }
  .assignment__poster {
    width: 100%;
    height: 0;
    padding-bottom: 56.26667%;
    margin-bottom: 3rem;
    overflow: hidden;
    background: center center no-repeat;
    background-size: cover; }
    @media print {
      .assignment__poster {
        display: none; } }
    .assignment__poster img {
      display: none; }
    @media (min-width: 768px) {
      .card--large .assignment__poster {
        display: table-cell;
        width: 70%;
        height: auto;
        padding: 0;
        vertical-align: top; }
        .card--large .assignment__poster img {
          display: block;
          visibility: hidden;
          width: 100%; } }
    .ngdialog.poster .assignment__poster {
      -webkit-animation-name: slideInDown;
      -moz-animation-name: slideInDown;
      animation-name: slideInDown;
      -webkit-animation-delay: 0;
      -moz-animation-delay: 0;
      animation-delay: 0;
      -webkit-animation-duration: 1s;
      -moz-animation-duration: 1s;
      animation-duration: 1s;
      -webkit-animation-fill-mode: both;
      -moz-animation-fill-mode: both;
      animation-fill-mode: both;
      margin: 0;
      box-shadow: 0 0 10rem 0 rgba(0, 0, 0, 0.25); }
  .assignment__thumb {
    float: left;
    max-width: 0;
    overflow: hidden; }
    @media print {
      .assignment__thumb {
        display: none; } }
    @media (max-width: 767px) {
      .assignment__thumb {
        display: none; } }
    .assignment__thumb img {
      display: block;
      height: auto; }
    .allowThumb .assignment__thumb {
      max-width: 20rem;
      margin-right: 1rem; }
    .assignment__thumb + div {
      overflow: hidden; }
  .assignment__name {
    font-weight: 300;
    font-size: 1.9rem;
    line-height: 2.2rem;
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    margin: 0;
    width: 85%; }
    @media (min-width: 768px) {
      .assignment__name {
        font-weight: 300;
        font-size: 2.4rem;
        line-height: 2.7rem;
        width: 89%; } }
    @media (min-width: 850px) {
      .assignment__name {
        font-weight: 300;
        font-size: 2.6rem;
        line-height: 3.1rem; } }
    .card-listings--mod-three .assignment__name {
      font-weight: 300;
      font-size: 1.9rem;
      line-height: 2.2rem; }
  .assignment__due {
    height: 5rem;
    width: 5rem;
    font-size: 1.4rem;
    line-height: 0.9em;
    display: block;
    border-radius: 50%;
    color: #ffffff;
    font-weight: 900;
    text-align: center;
    text-transform: uppercase;
    padding-top: .75rem; }
    @media print {
      .assignment__due {
        display: none; } }
    .assignment__due:before {
      display: block;
      font-size: .8rem;
      content: 'Due'; }
    .assignment__due--closed {
      font-size: 0;
      line-height: 5rem;
      padding: 0; }
      .assignment__due--closed:before {
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: "";
        font-size: 3.5rem; }
  .assignment__bookshelf {
    font-size: 1.5rem;
    line-height: 1.625; }
    @media (min-width: 768px) {
      .assignment__bookshelf {
        position: absolute;
        top: 2rem;
        right: 0;
        background: #ffffff;
        padding: .5rem 1.25rem;
        border: 1px solid rgba(28, 28, 28, 0.1);
        border-radius: 3px; }
        .onav__assignment-meta .assignment__bookshelf {
          position: static; }
          .onav__assignment-meta .assignment__bookshelf a {
            font-size: 1.0em !important; } }
    .assignment__bookshelf a {
      color: #bfd730; }
      .assignment__bookshelf a:before {
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: ""; }
  .assignment__icon {
    height: 3.6rem;
    width: 3.6rem;
    -webkit-box-reflect: below 1px -webkit-linear-gradient(bottom, rgba(255, 255, 255, 0.3) 0%, transparent 60%, transparent 100%); }
  .assignment__meta {
    margin: 0;
    padding: 0;
    list-style: none;
    font-size: 1.5rem;
    line-height: 1.625; }
    .assignment__meta::after {
      clear: both;
      content: "";
      display: table; }
    .assignment__meta > li, .assignment__meta > dd {
      margin: 0; }
    .assignment__meta li {
      display: block;
      float: left; }
    .assignment__meta li + li:before {
      margin-right: 1.2rem;
      margin-left: 1.2rem;
      content: '•'; }
    .assignment__meta--no-separators li {
      padding-right: 2em; }
    .assignment__meta--no-separators li + li:before {
      margin: 0;
      content: ''; }
    .assignment__meta .meta__edited {
      display: block; }
      @media (min-width: 768px) {
        .assignment__meta .meta__edited {
          display: initial;
          padding-left: .5rem; } }
  .assignment__cta {
    font-size: 1.6rem;
    line-height: 3.4rem;
    background-color: #fdb913;
    background-image: -webkit-linear-gradient(#fdb913, #faa21b);
    background-image: linear-gradient(#fdb913, #faa21b);
    display: inline-block;
    height: 3.4rem;
    padding: 0 23px;
    color: #ffffff !important;
    text-transform: none;
    border: none;
    vertical-align: middle;
    font-weight: 400;
    border-radius: .5rem;
    position: relative;
    /* Colors */
    background: transparent;
    border: 1px solid rgba(147, 149, 152, 0.5);
    color: #939598 !important;
    /* Size */
    padding-right: 15px;
    padding-left: 15px;
    font-size: 1.3rem;
    line-height: 30px;
    height: 30px;
    /* Icon */
    /* Mouse Actions */
    font-size: 1.3rem; }
    .assignment__cta[disabled] {
      opacity: .5; }
    .assignment__cta.loading {
      opacity: 1;
      color: rgba(255, 255, 255, 0) !important; }
    .assignment__cta[class*='icon']:before {
      margin-right: .5rem; }
    .assignment__cta:active {
      top: 1px; }
  .assignment__pastdue {
    font-size: 1.3rem;
    line-height: 1.625;
    font-weight: 600;
    margin-top: .5rem !important;
    text-transform: uppercase; }
  .assignment__nav {
    margin: 0;
    padding: 0;
    list-style: none;
    display: -webkit-box;
    display: -moz-box;
    display: box;
    display: -webkit-flex;
    display: -moz-flex;
    display: -ms-flexbox;
    display: flex;
    clear: both;
    padding-top: 1.5rem;
    font-size: 1.1rem;
    counter-reset: li; }
    .assignment__nav::after {
      clear: both;
      content: "";
      display: table; }
    .assignment__nav > li, .assignment__nav > dd {
      margin: 0; }
    @media print {
      .assignment__nav {
        display: none; } }
    @media (min-width: 768px) {
      .assignment__nav {
        font-size: 1.5rem;
        line-height: 1.625; } }
    .assignment__nav-tight {
      padding-top: 0; }
    .assignment__nav li {
      -webkit-box-flex: 1;
      -moz-box-flex: 1;
      box-flex: 1;
      -webkit-flex: 1;
      -moz-flex: 1;
      -ms-flex: 1;
      flex: 1;
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      display: block;
      background: #ffffff;
      position: relative;
      top: 1px;
      counter-increment: li; }
      .assignment__nav li.stateDisabled {
        background: #e1e1e1; }
    .assignment__nav li + li {
      border-left: 1px solid #e1e2e3; }
    .assignment__nav a {
      display: block;
      text-align: center;
      color: #939598;
      text-transform: uppercase;
      position: relative;
      padding: 1rem 0 .5rem;
      line-height: 1em; }
      .assignment__nav a:before {
        display: block;
        font-size: 1.3em;
        margin: 0 0 .5rem;
        vertical-align: middle;
        position: relative; }
        @media (min-width: 768px) {
          .assignment__nav a:before {
            font-size: .9em;
            margin-bottom: .25rem; } }
        @media (min-width: 850px) {
          .assignment__nav a:before {
            font-size: 1.5rem;
            margin-bottom: .5rem; } }
      .assignment__nav a:after {
        position: absolute;
        top: 0.3rem;
        left: 0.5rem;
        content: counter(li) ".";
        color: rgba(147, 149, 152, 0.7); }
      .assignment__nav a.no-numbering:after {
        content: ''; }
    .assignment__nav .active {
      background: #00abe6; }
      .assignment__nav .active a, .assignment__nav .active a:after, .assignment__nav .active span {
        color: #ffffff !important; }
    .assignment__nav--disabled {
      background: #000; }
  .assignment__tools {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    margin: 0;
    padding: 0;
    list-style: none;
    text-align: right; }
    .assignment__tools::after {
      clear: both;
      content: "";
      display: table; }
    .assignment__tools > li, .assignment__tools > dd {
      margin: 0; }
    @media print {
      .assignment__tools {
        display: none; } }
    .assignment__tools .tools__btn {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      font-size: 11px;
      line-height: 22px;
      display: block;
      color: #ffffff !important;
      text-transform: uppercase;
      background: #babbbd;
      border-radius: .3rem;
      padding: 2px 7px 0;
      font-weight: 600; }
      .assignment__tools .tools__btn:before {
        margin-right: .75rem;
        top: 0; }
      @media (max-width: 767px) {
        .assignment__tools .tools__btn[class*='icon'] {
          font-size: 0; }
        .assignment__tools .tools__btn:before {
          font-size: 1.25rem;
          padding: 0rem;
          margin-right: 0; } }
      .assignment__tools .tools__btn--connected {
        border-bottom-left-radius: 0;
        border-top-left-radius: 0;
        margin-left: -.25rem; }
    .assignment__tools .btn-group .tools__btn {
      display: inline-block;
      border-radius: 0; }
      .assignment__tools .btn-group .tools__btn:first-child {
        border-bottom-left-radius: 0.3rem;
        border-top-left-radius: 0.3rem; }
      .assignment__tools .btn-group .tools__btn:last-child {
        border-bottom-right-radius: 0.3rem;
        border-top-right-radius: 0.3rem; }
      .assignment__tools .btn-group .tools__btn:only-child {
        border-radius: .3rem; }
    .assignment__tools li {
      display: inline-block; }
    .assignment__tools li + li {
      margin-left: .5rem; }
      @media (min-width: 768px) {
        .assignment__tools li + li {
          margin-left: .25rem; } }
    @media (max-width: 767px) {
      .assignment__tools span {
        display: none; } }
    @media (max-width: 767px) {
      .assignment__tools li.fullscreen-button {
        display: none; } }
    .assignment__tools .active {
      background: #faa21b; }
    .assignment__tools--toolbar {
      padding: 15px 0; }
      @media (max-width: 767px) {
        .assignment__tools--toolbar {
          margin-left: -10px;
          margin-right: -10px;
          padding-left: 10px;
          padding-right: 10px;
          border-bottom: 1px dotted #939598; }
          .assignment__tools--toolbar span {
            display: none; } }
      .assignment__tools--toolbar li {
        margin-right: 31px; }
        @media (max-width: 767px) {
          .assignment__tools--toolbar li {
            margin-left: 20px;
            margin-right: 0; } }
        @media (min-width: 850px) {
          .assignment__tools--toolbar li {
            margin-right: 40px; } }
        .assignment__tools--toolbar li:last-child {
          margin-right: 0; }
      .assignment__tools--toolbar i {
        font-size: 20px;
        position: relative;
        top: 2px; }
    .headline--hr .assignment__tools {
      float: right;
      line-height: inherit;
      margin-top: -.5rem; }
    .headline--hr dir-pagination-controls + .assignment__tools {
      clear: both;
      margin: 2rem 0; }
  .card-listings .assignment .assignment__poster {
    margin-bottom: 0; }
  .card-listings .assignment .assignment__name {
    margin-bottom: .5rem; }
  .card-listings .assignment .assignment__meta li {
    display: block;
    float: none;
    line-height: 1.5; }
    .card-listings .assignment .assignment__meta li:before {
      display: none; }
  .card-listings .assignment .assignment__cta {
    position: absolute;
    bottom: 3.5rem;
    left: 1.5rem; }
    .ios-mode .card-listings .assignment .assignment__cta {
      display: none; }
  .card-listings .assignment .assignment__due, .card-listings .assignment .assignment__icon {
    position: absolute;
    top: auto;
    right: 1.5rem;
    bottom: 3.5rem; }
  .card-listings .assignment .card__body {
    padding-bottom: 8rem; }
  .card-listings .assignment .card__unselected-border {
    border: none; }
  .card-listings .assignment .card__selected-border {
    border: 2px solid #f77e0d; }
  @media (min-width: 768px) {
    .card-listings .assignment.card-listings--fullwidth .card__body {
      padding-bottom: 1.5rem; } }
  .card-listings .assignment .selected {
    position: absolute;
    right: 1.5rem;
    bottom: 1.5rem; }
  .card-listings .assignment .selected i {
    font-size: 2.5rem; }
  .card-listings--listview .assignment .assignment__poster {
    display: none; }
    @media (min-width: 768px) {
      .card-listings--listview .assignment .assignment__poster {
        display: block;
        width: 27.3rem;
        padding-bottom: 15.4rem;
        margin: 0;
        height: auto;
        float: left;
        background-position: 0 0; }
        .card-listings--listview .assignment .assignment__poster img {
          display: block;
          visibility: hidden;
          position: absolute; } }
  .card-listings--listview .assignment .assignment__due, .card-listings--listview .assignment .assignment__icon {
    bottom: auto;
    top: 1.5rem; }
  .card-listings--listview .assignment .assignment__icon {
    height: 4rem;
    width: 4rem; }
  .card-listings--listview .assignment .card__body {
    padding-bottom: 1.5rem; }
  .card-listings--fullwidth .assignment .card__body {
    padding-bottom: 1.5rem; }
  .assignment.card-listings--review-mode .card:after {
    position: absolute;
    top: auto;
    right: 0;
    bottom: 0;
    left: 0;
    font-size: 1rem;
    display: block;
    height: 1.5rem;
    background: #1c1c1c;
    color: #ffffff;
    font-weight: 700;
    content: 'Review Mode';
    text-align: center;
    text-transform: uppercase; }
  @media (min-width: 768px) {
    .assignment.card--large .assignment__cta,
    .assignment .card--large .assignment__cta {
      position: static;
      margin-top: 1rem; } }
  .assignment.card--large .assignment__due, .assignment.card--large .assignment__icon,
  .assignment .card--large .assignment__due,
  .assignment .card--large .assignment__icon {
    position: absolute;
    top: 2rem;
    right: 2rem; }
  @media (max-width: 767px) {
    .assignment.card--large .assignment__meta li,
    .assignment .card--large .assignment__meta li {
      float: none; }
      .assignment.card--large .assignment__meta li:before,
      .assignment .card--large .assignment__meta li:before {
        display: none; } }
  .assignment [class*='headline'][sticky] {
    padding-top: 1.2rem; }

@media (min-width: 1150px) {
  .auto-two-col {
    -webkit-column-count: 2;
    -moz-column-count: 2;
    column-count: 2;
    -webkit-column-gap: 24px;
    -moz-column-gap: 24px;
    column-gap: 24px; } }

@media print {
  .auto-two-col--print {
    -webkit-column-count: 2;
    -moz-column-count: 2;
    column-count: 2;
    -webkit-column-gap: 24px;
    -moz-column-gap: 24px;
    column-gap: 24px; } }

.auto-two-col > * {
  /* This will soon be in bourbon */
  -webkit-column-break-inside: avoid;
  page-break-inside: avoid;
  break-inside: avoid; }

.bg-white {
  background: #ffffff; }

[ss-bind-html] table td,
[ng-bind-html] table td {
  border: 1px solid #e1e1e1;
  padding: .5rem 1rem; }

[ss-bind-html] table strong,
[ng-bind-html] table strong {
  font-weight: 600; }

.blast-rating-header {
  display: flex;
  justify-content: space-between; }
  .blast-rating-header--teacher {
    float: right; }

.blast-rating-reviewer {
  display: block; }

.blast-rating .rating {
  flex: 0 0 auto;
  margin-left: 2rem; }

.blast-status {
  font-size: 1.5rem;
  line-height: 1.625;
  margin-top: 4rem; }
  .blast-status strong {
    font-weight: 600; }
  .blast-status ul {
    margin-top: 0;
    list-style: none;
    padding-left: 0; }

.blast-top-ten {
  list-style: none;
  padding-left: 0; }
  .blast-top-ten .top-ten__interval {
    margin-right: .1em; }
  .blast-top-ten .top-ten__score {
    float: right; }
  .blast-top-ten .top-ten__nickname {
    -webkit-transition: all 0.3s ease-in-out;
    -moz-transition: all 0.3s ease-in-out;
    transition: all 0.3s ease-in-out; }
    .blast-top-ten .top-ten__nickname:after {
      -webkit-transition: all 0.3s ease-in-out;
      -moz-transition: all 0.3s ease-in-out;
      transition: all 0.3s ease-in-out;
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      color: rgba(147, 149, 152, 0.65);
      margin-left: 6px;
      font-size: 85%; }
    .blast-top-ten .top-ten__nickname.active:after {
      -webkit-transform: rotate(90deg) translate3d(1px, 0, 0);
      -moz-transform: rotate(90deg) translate3d(1px, 0, 0);
      -ms-transform: rotate(90deg) translate3d(1px, 0, 0);
      -o-transform: rotate(90deg) translate3d(1px, 0, 0);
      transform: rotate(90deg) translate3d(1px, 0, 0);
      color: #faa21b; }
  .blast-top-ten .top-ten__post {
    -webkit-transition: max-height 0.3s ease-in-out;
    -moz-transition: max-height 0.3s ease-in-out;
    transition: max-height 0.3s ease-in-out;
    max-height: 50rem;
    overflow: hidden;
    margin-top: 0;
    padding-top: 0.5em;
    padding-bottom: 0.5em;
    line-height: 1.3; }
    .blast-top-ten .top-ten__post.ng-hide {
      max-height: 0; }

.blast__poster {
  position: relative;
  overflow: hidden;
  margin-bottom: 2.5rem; }
  .blast__poster img {
    display: block;
    width: 100%;
    max-width: none; }
  .blast__poster.has-video img {
    visibility: hidden; }
    html[platform=cordova] .blast__poster.has-video img {
      visibility: visible; }
  .blast__poster video {
    position: absolute;
    width: 100%; }

.blast__header {
  position: absolute;
  right: 0;
  bottom: 0;
  left: 0;
  background: rgba(0, 0, 0, 0.35);
  padding: 2.5rem;
  color: #ffffff; }
  @media print {
    .blast__header {
      position: static;
      margin: 1.5rem 0;
      padding: 0; } }
  .blast__header .assignment__due,
  .blast__header .assignment__icon {
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    position: absolute;
    top: 50%;
    right: 2.5rem; }

.blast__title {
  color: inherit;
  font-weight: 400; }

.blast__slug {
  font-weight: 300;
  font-size: 1.9rem;
  line-height: 2.2rem;
  margin-top: 3px;
  color: inherit; }

.blast__date {
  font-weight: 300;
  font-size: 1.7rem;
  line-height: 1.8rem;
  color: inherit; }

blockquote {
  margin: 1em 0;
  border-left: 4px solid #e1e1e1;
  padding-left: 1em;
  opacity: .9; }

.bookshelf {
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out;
  font-size: 1.6rem;
  line-height: 3.4rem;
  background-color: #fdb913;
  background-image: -webkit-linear-gradient(#fdb913, #faa21b);
  background-image: linear-gradient(#fdb913, #faa21b);
  display: inline-block;
  height: 3.4rem;
  padding: 0 23px;
  color: #ffffff !important;
  text-transform: none;
  border: none;
  vertical-align: middle;
  font-weight: 400;
  border-radius: .5rem;
  position: relative;
  /* Colors */
  background: transparent;
  border: 1px solid rgba(147, 149, 152, 0.5);
  color: #939598 !important;
  /* Size */
  /* Icon */
  /* Mouse Actions */
  font-weight: 500;
  color: #faa21b !important; }
  .bookshelf[disabled] {
    opacity: .5; }
  .bookshelf.loading {
    opacity: 1;
    color: rgba(255, 255, 255, 0) !important; }
  .bookshelf[class*='icon']:before {
    margin-right: .5rem; }
  .bookshelf:active {
    top: 1px; }
  .bookshelf:before {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: ""; }

.btn {
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out;
  font-size: 1.6rem;
  line-height: 3.4rem;
  background-color: #fdb913;
  background-image: -webkit-linear-gradient(#fdb913, #faa21b);
  background-image: linear-gradient(#fdb913, #faa21b);
  display: inline-block;
  height: 3.4rem;
  padding: 0 23px;
  color: #ffffff !important;
  text-transform: none;
  border: none;
  vertical-align: middle;
  font-weight: 400;
  border-radius: .5rem;
  position: relative;
  /* Colors */
  /* Size */
  /* Icon */
  /* Mouse Actions */
  /* Sizes */
  /* Colors */ }
  .btn[disabled] {
    opacity: .5; }
  .btn.loading {
    opacity: 1;
    color: rgba(255, 255, 255, 0) !important; }
  .btn[class*='icon']:before {
    margin-right: .5rem; }
  .btn:active {
    top: 1px; }
  .btn--block {
    display: block;
    width: 100%;
    text-align: center; }
  .btn--small {
    padding-right: 15px;
    padding-left: 15px;
    font-size: 1.3rem;
    line-height: 30px;
    height: 30px; }
  .btn--white {
    background: #ffffff;
    border: 1px solid rgba(147, 149, 152, 0.5);
    color: #939598 !important;
    color: #faa21b !important; }
  .btn--green {
    background: -webkit-linear-gradient(#ccdf5b, #9db222);
    background: linear-gradient(#ccdf5b, #9db222); }
    .btn--green:hover {
      background: -webkit-linear-gradient(#c6db45, #b0c726);
      background: linear-gradient(#c6db45, #b0c726); }
  .btn--blue {
    background: -webkit-linear-gradient(#1ac4ff, #0085b3);
    background: linear-gradient(#1ac4ff, #0085b3); }
    .btn--blue:hover {
      background: -webkit-linear-gradient(#01beff, #0098cd);
      background: linear-gradient(#01beff, #0098cd); }
  .btn--orange {
    background: -webkit-linear-gradient(#fbb64d, #dd8805);
    background: linear-gradient(#fbb64d, #dd8805); }
    .btn--orange:hover {
      background: -webkit-linear-gradient(#fbac34, #f69705);
      background: linear-gradient(#fbac34, #f69705); }
  .btn--red {
    background: -webkit-linear-gradient(#e37d7a, #cc302b);
    background: linear-gradient(#e37d7a, #cc302b); }
    .btn--red:hover {
      background: -webkit-linear-gradient(#de6965, #d63f3b);
      background: linear-gradient(#de6965, #d63f3b); }
  .btn--plain {
    background: transparent;
    border: 1px solid rgba(147, 149, 152, 0.5);
    color: #939598 !important; }
  .btn--solid-orange {
    background: #faa21b; }
    .btn--solid-orange::before {
      opacity: .5;
      margin-right: .5rem; }
  .btn--solid-red {
    background: #da5450; }
    .btn--solid-red::before {
      opacity: .5;
      margin-right: .5rem; }
  .btn--solid-white {
    background: #ffffff;
    color: #faa21b !important;
    border: solid 1px #e1e1e1; }
    .btn--solid-white::before {
      opacity: .5;
      margin-right: .5rem; }
  .btn--reset {
    background: none;
    border: none; }
  .btn--icon-only::before {
    margin-right: 0 !important; }
  .btn--right {
    float: right;
    margin-left: 20px; }
  .btn--plain-primary {
    background: transparent;
    border: 1px solid rgba(147, 149, 152, 0.5);
    color: #939598 !important;
    border-color: #69940c; }
  .btn--plain-secondary {
    background: transparent;
    border: 1px solid rgba(147, 149, 152, 0.5);
    color: #939598 !important;
    border-color: #faa21b; }
  .btn[droppable]::after {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: "";
    margin-left: .5rem;
    opacity: .5; }
  .btn.active::after {
    -webkit-transform: rotate(-180deg);
    -moz-transform: rotate(-180deg);
    -ms-transform: rotate(-180deg);
    -o-transform: rotate(-180deg);
    transform: rotate(-180deg); }
  .btn::after {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out; }

@media print {
  .btn, button {
    display: none !important; } }

.button-list {
  margin: 0;
  padding: 0;
  list-style: none;
  margin-top: 1rem; }
  .button-list::after {
    clear: both;
    content: "";
    display: table; }
  .button-list > li, .button-list > dd {
    margin: 0; }
  .button-list li {
    border-bottom: 1px solid #e1e1e1;
    position: relative;
    padding-right: 2.5rem; }
    .button-list li:last-child {
      border-bottom: 0; }
    .button-list li.active {
      color: #faa21b; }
      .button-list li.active:after {
        font-size: 1.5rem;
        line-height: 1.625;
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: "";
        -webkit-transform: translateY(-50%);
        -moz-transform: translateY(-50%);
        -ms-transform: translateY(-50%);
        -o-transform: translateY(-50%);
        transform: translateY(-50%);
        position: absolute;
        top: 50%;
        right: 0; }
    .button-list li button {
      background: none;
      border: none;
      margin: 0;
      padding: 0;
      font-size: inherit;
      line-height: inherit;
      font-size: 1.5rem;
      line-height: 1.625;
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      display: block;
      width: 100%;
      text-align: left;
      padding: 1rem 0; }
      .button-list li button:hover {
        color: #faa21b; }

.callout {
  font-size: 1.6rem;
  line-height: 1.5;
  background: #f5f5f5;
  border-radius: 5px;
  padding: 4rem 5rem;
  display: inline-block; }
  .callout__headline {
    font-size: 2.1rem;
    line-height: 1.2;
    margin-bottom: 2.5rem; }
  .callout__content .content {
    display: block; }
    .callout__content .content::after {
      clear: both;
      content: "";
      display: table; }
    .callout__content .content__image {
      margin-bottom: 2.5rem; }
      .callout__content .content__image img {
        width: 100%; }
    @media (max-width: 767px) {
      .callout__content .content__details [col-sm='12'] + [col-sm='12'] {
        margin-top: 0; } }

.card {
  position: relative;
  border: 1px solid #e1e1e1;
  background: #ffffff; }
  @media print {
    .card {
      border: none; } }
  .card-listings .card--large {
    display: table;
    width: 100%; }
  .card--no-border {
    border: none; }
  .card__body {
    padding: 1.5rem 1.5rem 0;
    position: relative; }
    .card--no-border .card__body {
      padding-right: 0;
      padding-left: 0;
      border: none; }
    .card-listings .card__body {
      overflow: hidden; }
    @media (min-width: 768px) {
      .card-listings .card--large .card__body {
        display: table-cell;
        vertical-align: top; } }
    .card__body-short {
      padding-bottom: 1.5rem !important; }

.card-listings {
  margin: 0;
  padding: 0;
  list-style: none;
  display: block;
  clear: both;
  display: block;
  position: relative;
  margin-left: -12px;
  margin-right: -12px;
  margin: 0 -10px 0; }
  .card-listings::after {
    clear: both;
    content: "";
    display: table; }
  .card-listings > li, .card-listings > dd {
    margin: 0; }
  .card-listings::after {
    clear: both;
    content: "";
    display: table; }
  .card-listings > * {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    .card-listings > *:last-child {
      margin-right: 0; }
    @media print {
      .card-listings > * {
        float: left !important; } }
  @media (min-width: 768px) {
    .card-listings {
      display: block;
      clear: both;
      display: flex;
      position: relative;
      margin-left: -12px;
      margin-right: -12px;
      display: -webkit-box;
      display: -moz-box;
      display: box;
      display: -webkit-flex;
      display: -moz-flex;
      display: -ms-flexbox;
      display: flex;
      -webkit-box-orient: horizontal;
      -moz-box-orient: horizontal;
      box-orient: horizontal;
      -webkit-flex-direction: row;
      -moz-flex-direction: row;
      flex-direction: row;
      -ms-flex-direction: row;
      -webkit-box-lines: multiple;
      -moz-box-lines: multiple;
      box-lines: multiple;
      -webkit-flex-wrap: wrap;
      -moz-flex-wrap: wrap;
      -ms-flex-wrap: wrap;
      flex-wrap: wrap; }
      .card-listings::after {
        clear: both;
        content: "";
        display: table; }
      .card-listings > * {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 100%;
        width: 100%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0; }
        .card-listings > *:last-child {
          margin-right: 0; } }
    @media print and (min-width: 768px) {
      .card-listings > * {
        float: left !important; } }
  .card-listings > li {
    padding-right: 10px;
    padding-left: 10px;
    margin-bottom: 2rem; }
    @media (min-width: 768px) {
      .card-listings > li {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 48.07692%;
        width: 50%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0;
        padding-right: 10px;
        padding-left: 10px;
        display: -webkit-box;
        display: -moz-box;
        display: box;
        display: -webkit-flex;
        display: -moz-flex;
        display: -ms-flexbox;
        display: flex; }
        .card-listings > li:last-child {
          margin-right: 0; } }
  @media print and (min-width: 768px) {
    .card-listings > li {
      float: left !important; } }
    @media (min-width: 850px) {
      .card-listings > li {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 30.76923%;
        width: 33.33333%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0;
        display: -webkit-box;
        display: -moz-box;
        display: box;
        display: -webkit-flex;
        display: -moz-flex;
        display: -ms-flexbox;
        display: flex; }
        .card-listings > li:last-child {
          margin-right: 0; } }
  @media print and (min-width: 850px) {
    .card-listings > li {
      float: left !important; } }
    .card-listings > li.card-listings--fullwidth {
      width: 100%; }
  @media (min-width: 850px) {
    .card-listings--mod-one > li:nth-child(-n+4),
    .card-listings--mod-two > li:nth-child(-n+2) {
      width: 50%; } }
  .card-listings--mod-three {
    margin-right: -4px;
    margin-left: -4px; }
    @media (min-width: 850px) {
      .card-listings--mod-three > li {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 22.11538%;
        width: 25%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0;
        padding-right: 4px;
        padding-left: 4px;
        display: -webkit-box;
        display: -moz-box;
        display: box;
        display: -webkit-flex;
        display: -moz-flex;
        display: -ms-flexbox;
        display: flex; }
        .card-listings--mod-three > li:last-child {
          margin-right: 0; } }
  @media print and (min-width: 850px) {
    .card-listings--mod-three > li {
      float: left !important; } }
  .card-listings .card {
    -webkit-transition: box-shadow 0.15s ease-in-out;
    -moz-transition: box-shadow 0.15s ease-in-out;
    transition: box-shadow 0.15s ease-in-out;
    display: block;
    width: 100%;
    color: #4b4a4b;
    box-shadow: 0 0.25rem 0.7rem 0 rgba(1, 1, 1, 0.2); }
  .card-listings--listview {
    margin: 0;
    padding: 0;
    list-style: none;
    display: block;
    clear: both;
    display: block;
    position: relative;
    margin-left: -12px;
    margin-right: -12px; }
    .card-listings--listview::after {
      clear: both;
      content: "";
      display: table; }
    .card-listings--listview > li, .card-listings--listview > dd {
      margin: 0; }
    .card-listings--listview::after {
      clear: both;
      content: "";
      display: table; }
    .card-listings--listview > * {
      float: left;
      display: block;
      margin-right: 3.84615%;
      width: 100%;
      width: 100%;
      padding-left: 12px;
      padding-right: 12px;
      margin-right: 0; }
      .card-listings--listview > *:last-child {
        margin-right: 0; }
      @media print {
        .card-listings--listview > * {
          float: left !important; } }
    .card-listings--listview > li {
      width: 100%;
      float: none; }
    .card-listings--listview > li + li {
      margin-top: 1.5rem; }
    .card-listings--listview .card {
      display: block; }
      .card-listings--listview .card::after {
        clear: both;
        content: "";
        display: table; }
      .card-listings--listview .card__body {
        padding-right: 8rem; }
    .card-listings--listview .assignment__cta {
      display: none; }

.chart-legend, .bar-legend, .line-legend, .pie-legend, .radar-legend, .polararea-legend, .doughnut-legend {
  list-style-type: none;
  margin-top: 5px;
  text-align: center; }
  .chart-legend li, .bar-legend li, .line-legend li, .pie-legend li, .radar-legend li, .polararea-legend li, .doughnut-legend li {
    display: inline-block;
    white-space: nowrap;
    position: relative;
    margin-bottom: 4px;
    border-radius: 5px;
    padding: 2px 8px 2px 28px;
    font-size: smaller;
    cursor: default; }
    .chart-legend li span, .bar-legend li span, .line-legend li span, .pie-legend li span, .radar-legend li span, .polararea-legend li span, .doughnut-legend li span {
      display: block;
      position: absolute;
      left: 0;
      top: 0;
      width: 20px;
      height: 20px;
      border-radius: 5px; }

.checkbox-list {
  padding: 0;
  margin: 0;
  list-style: none; }
  .checkbox-list ul {
    margin-top: .8rem;
    padding-left: 2.5rem; }
  .checkbox-list .form__checkbox {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    margin: 0; }

[color-theme='blast'] {
  /* Text Color */
  /* Background Color */ }
  [color-theme='blast'] .apply-text-color,
  [color-theme='blast'] .assignment__meta li:before {
    color: #9a488e; }
  [color-theme='blast'] .apply-bg-color {
    background-color: #9a488e; }
  [color-theme='blast'] .apply-border-color {
    border-color: #9a488e; }

.card-listings--review-mode [color-theme='blast'].card:after {
  background-color: #9a488e; }

[color-theme='synctv'] {
  /* Text Color */
  /* Background Color */ }
  [color-theme='synctv'] .apply-text-color,
  [color-theme='synctv'] .assignment__meta li:before {
    color: #92af2b; }
  [color-theme='synctv'] .apply-bg-color {
    background-color: #92af2b; }
  [color-theme='synctv'] .apply-border-color {
    border-color: #92af2b; }

.card-listings--review-mode [color-theme='synctv'].card:after {
  background-color: #92af2b; }

[color-theme='reading'] {
  /* Text Color */
  /* Background Color */ }
  [color-theme='reading'] .apply-text-color,
  [color-theme='reading'] .assignment__meta li:before {
    color: #00abe6; }
  [color-theme='reading'] .apply-bg-color {
    background-color: #00abe6; }
  [color-theme='reading'] .apply-border-color {
    border-color: #00abe6; }

.card-listings--review-mode [color-theme='reading'].card:after {
  background-color: #00abe6; }

[color-theme='writing'] {
  /* Text Color */
  /* Background Color */ }
  [color-theme='writing'] .apply-text-color,
  [color-theme='writing'] .assignment__meta li:before {
    color: #ffdc19; }
  [color-theme='writing'] .apply-bg-color {
    background-color: #ffdc19; }
  [color-theme='writing'] .apply-border-color {
    border-color: #ffdc19; }

.card-listings--review-mode [color-theme='writing'].card:after {
  background-color: #ffdc19; }

[color-theme='skill'] {
  /* Text Color */
  /* Background Color */ }
  [color-theme='skill'] .apply-text-color,
  [color-theme='skill'] .assignment__meta li:before {
    color: #faa21b; }
  [color-theme='skill'] .apply-bg-color {
    background-color: #faa21b; }
  [color-theme='skill'] .apply-border-color {
    border-color: #faa21b; }

.card-listings--review-mode [color-theme='skill'].card:after {
  background-color: #faa21b; }

.container {
  max-width: 1150px;
  margin-left: auto;
  margin-right: auto;
  padding-right: 2.5rem;
  padding-left: 2.5rem;
  position: relative;
  min-width: 320px; }
  .container::after {
    clear: both;
    content: "";
    display: table; }
  @media (max-width: 1149px) {
    .container[collapse='large'] {
      padding-right: 0;
      padding-left: 0; } }
  @media (max-width: 849px) {
    .container[collapse='medium'] {
      padding-right: 0;
      padding-left: 0; } }
  @media (max-width: 767px) {
    .container[collapse='small'] {
      padding-right: 0;
      padding-left: 0; } }
  .page-header + .container {
    margin-top: 2.5rem; }
  .container .container {
    padding-right: 0;
    padding-left: 0; }
  @media screen and (max-width: 1200px) {
    .container--breakout {
      padding-right: 5rem;
      padding-left: 5rem; } }
  .container--breakout, .container--breakout__column {
    transition: all 0.3s ease-out;
    transition-property: width, max-width; }

.cropper-container .cropper-drag-box {
  background-color: #1c1c1c;
  opacity: .7; }

.cropper-container .cropper-view-box {
  outline-color: #e1e1e1; }

.cropper-container .cropper-point {
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out;
  height: 1rem;
  width: 1rem;
  border-radius: 5rem;
  background-color: #e1e1e1;
  opacity: 1; }
  .cropper-container .cropper-point:hover {
    background-color: #faa21b; }

.cropper-container .cropper-center {
  opacity: 1; }
  .cropper-container .cropper-center::before, .cropper-container .cropper-center::after {
    background-color: #e1e1e1; }
  .cropper-container .cropper-center::before {
    width: 1.4rem;
    height: .2rem;
    left: -.6rem; }
  .cropper-container .cropper-center::after {
    width: .2rem;
    height: 1.4rem;
    top: -.6rem; }

.cropper-container .cropper-line, .cropper-container .cropper-face {
  background-color: transparent; }

.data-table .table__outer-wrapper {
  position: relative; }
  @media (max-width: 849px) {
    .data-table .table__outer-wrapper::after {
      position: absolute;
      right: 0;
      bottom: 0;
      background: -webkit-linear-gradient( left , rgba(255, 255, 255, 0), #ffffff);
      background: linear-gradient(to right, rgba(255, 255, 255, 0), #ffffff);
      content: '';
      width: 5rem;
      height: 100%;
      pointer-events: none; } }

.data-table .table__inner-wrapper {
  width: 100%; }
  @media (max-width: 849px) {
    .data-table .table__inner-wrapper {
      overflow-x: scroll; } }

@media (max-width: 849px) {
  .data-table .table__head, .data-table .table__body {
    min-width: 850px; } }

.data-table .table__head {
  padding: 2rem 0 1.5rem;
  border-bottom: 1px solid rgba(225, 225, 225, 0.7);
  box-shadow: 0 2px 3px rgba(28, 28, 28, 0.05);
  background: #fff; }

.data-table .table__controls {
  margin-bottom: 2.5rem; }
  .data-table .table__controls::after {
    clear: both;
    content: "";
    display: table; }
  .data-table .table__controls .controls__left {
    float: left;
    padding-left: 0;
    margin: 0; }
    .data-table .table__controls .controls__left .droppable-overlay li {
      margin-left: 0; }
    .data-table .table__controls .controls__left li {
      margin: 0 0 0 1rem; }
      .data-table .table__controls .controls__left li:first-child {
        margin: 0; }
  .data-table .table__controls .controls__right {
    float: right;
    margin: 0; }
  .data-table .table__controls li {
    font-size: 1.5rem;
    line-height: 1.625;
    display: inline-block;
    vertical-align: middle; }
  .data-table .table__controls .btn {
    padding-right: 1.5rem;
    padding-left: 1.5rem;
    font-size: 1.5rem;
    line-height: 1.625; }
    .data-table .table__controls .btn:before {
      font-size: 90%;
      opacity: .8; }

.data-table .table__search {
  position: relative;
  margin-top: 1rem; }
  .data-table .table__search:before {
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    position: absolute;
    top: 50%;
    left: 1rem; }
  .data-table .table__search span[class*='icon'] {
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    position: absolute;
    top: 50%;
    left: 1rem;
    color: #939598;
    pointer-events: none; }
  .data-table .table__search input {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    font-size: 1.2rem;
    line-height: 1.6;
    background: #f5f5f5;
    border: 0.1rem solid #f5f5f5;
    border-radius: 5px;
    padding-left: 3rem; }

.data-table .table__sort {
  display: inline-block;
  margin-left: 2px;
  -webkit-transform: translateY(-2px) rotate(180deg);
  -moz-transform: translateY(-2px) rotate(180deg);
  -ms-transform: translateY(-2px) rotate(180deg);
  -o-transform: translateY(-2px) rotate(180deg);
  transform: translateY(-2px) rotate(180deg); }
  .data-table .table__sort:before {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: ""; }
  .data-table .table__sort.desc, .data-table .table__sort.DESC {
    -webkit-transform: translateY(0px) rotate(0deg);
    -moz-transform: translateY(0px) rotate(0deg);
    -ms-transform: translateY(0px) rotate(0deg);
    -o-transform: translateY(0px) rotate(0deg);
    transform: translateY(0px) rotate(0deg); }

.data-table .table__actions {
  text-align: right; }
  .data-table .table__actions a {
    color: #939598; }
  .data-table .table__actions .icon-lock {
    margin-right: 1.5rem; }
  .data-table .table__actions .icon-gear {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    white-space: nowrap; }
    .data-table .table__actions .icon-gear::after {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      margin-left: .5rem; }

.data-table .table__empty {
  font-size: 1.5rem;
  line-height: 1.625;
  padding: 4rem 0 2rem;
  text-align: center; }

.data-table .table__connected-logo {
  height: 2rem;
  width: 2rem;
  vertical-align: middle;
  margin-right: 1rem; }

.data-table table {
  width: 100%;
  table-layout: fixed; }

.data-table th, .data-table td {
  padding-right: 1rem;
  padding-left: 1rem;
  vertical-align: top; }
  .data-table th.single-word, .data-table td.single-word {
    overflow: hidden;
    text-overflow: ellipsis; }
  .data-table th:first-child, .data-table td:first-child {
    padding-left: 0; }
  .data-table th:last-child, .data-table td:last-child {
    padding-right: 0; }

.data-table th {
  font-size: 1.2rem;
  line-height: 1;
  font-weight: 500;
  text-align: left;
  text-transform: uppercase;
  color: #939598;
  white-space: nowrap; }
  .data-table th.sortable {
    cursor: pointer; }

.data-table td {
  padding-top: 1.5rem;
  padding-bottom: 1.5rem;
  font-size: 1.5rem;
  line-height: 1.3;
  border-top: 1px solid #e1e1e1;
  color: #4b4a4b; }

.data-table tr:first-child td {
  border-top: none; }

.data-table .icon-info {
  opacity: .5;
  font-size: 85%; }

.data-table .droppable-overlay li {
  display: block; }

.data-table.data-table--embedded .table__body {
  padding: 0; }

.date-range {
  font-size: 1.5rem;
  line-height: 1.625; }
  .date-range::after {
    clear: both;
    content: "";
    display: table; }
  .date-range .range__selector, .date-range .range__custom {
    display: block;
    float: left; }
  .date-range .range__custom {
    margin-top: -2rem;
    margin-left: 1rem; }
    .date-range .range__custom::after {
      clear: both;
      content: "";
      display: table; }
    .date-range .range__custom > * {
      display: inline-block; }
    .date-range .range__custom > span {
      padding-right: 1rem;
      padding-left: 1rem; }
    .date-range .range__custom .input__text {
      width: 130px; }

.dgo .focused {
  outline: auto 5px -webkit-focus-ring-color; }

.dgo__header {
  background-color: #f5f5f5;
  margin-bottom: 2rem;
  padding: 2rem;
  border-radius: 4px; }
  .dgo__header .headline {
    margin: 0; }

.dgo__prompt {
  margin-top: 1rem; }

.dgo__drawing {
  position: relative;
  margin-bottom: 1rem; }
  .dgo__drawing:before {
    display: block;
    content: "";
    width: 100%; }
  .dgo__drawing.rectangle:before {
    padding-top: 75%; }
  .dgo__drawing.square:before {
    padding-top: 100%; }
  .dgo__drawing.venn2:before {
    padding-top: 63.75%; }
  .dgo__drawing.venn3:before {
    padding-top: 92.5%; }
  .dgo__drawing svg {
    position: absolute;
    top: 0;
    left: 0;
    right: 0;
    bottom: 0; }
    .dgo__drawing svg path, .dgo__drawing svg circle, .dgo__drawing svg line {
      stroke: #4b4a4b; }
    .dgo__drawing svg text {
      fill: #4b4a4b; }

.dgo__helper {
  font-size: 1.5rem;
  line-height: 1.4;
  display: block;
  font-style: italic;
  color: #939598;
  margin-top: 1rem; }

.dgo-response-editor-inline {
  height: 100%;
  display: flex;
  flex-direction: column; }
  .dgo-response-editor-inline input, .dgo-response-editor-inline textarea {
    border: none; }
  .dgo-response-editor-inline textarea {
    resize: none; }
  .dgo-response-editor-inline__header ::-webkit-input-placeholder, .dgo-response-editor-inline__content ::-webkit-input-placeholder {
    font-style: italic; }
  .dgo-response-editor-inline__header :-moz-placeholder, .dgo-response-editor-inline__content :-moz-placeholder {
    font-style: italic; }
  .dgo-response-editor-inline__header ::-moz-placeholder, .dgo-response-editor-inline__content ::-moz-placeholder {
    font-style: italic; }
  .dgo-response-editor-inline__header :-ms-input-placeholder, .dgo-response-editor-inline__content :-ms-input-placeholder {
    font-style: italic; }
  .dgo-response-editor-inline__header {
    font-weight: bold;
    text-transform: uppercase;
    text-align: center;
    padding: 1rem; }
    .dgo-response-editor-inline__header h1, .dgo-response-editor-inline__header h2, .dgo-response-editor-inline__header h3, .dgo-response-editor-inline__header h4, .dgo-response-editor-inline__header h5, .dgo-response-editor-inline__header h6 {
      font-weight: bold; }
      .dgo-response-editor-inline__header h1.placeholder, .dgo-response-editor-inline__header h2.placeholder, .dgo-response-editor-inline__header h3.placeholder, .dgo-response-editor-inline__header h4.placeholder, .dgo-response-editor-inline__header h5.placeholder, .dgo-response-editor-inline__header h6.placeholder {
        font-style: italic; }
    .dgo-response-editor-inline__header button {
      border: none;
      padding: 0;
      background: transparent;
      font-weight: bold;
      text-transform: uppercase; }
      .dgo-response-editor-inline__header button:hover {
        color: #faa21b; }
      .dgo-response-editor-inline__header button.placeholder {
        font-style: italic; }
    .dgo-response-editor-inline__header textarea {
      border: 1px solid #e1e1e1; }
  .dgo-response-editor-inline__content {
    flex: 1;
    position: relative; }
    .dgo-response-editor-inline__content textarea {
      position: absolute;
      top: 0;
      right: 0;
      bottom: 0;
      left: 0;
      background: transparent; }

.dgo__cta {
  font-style: italic; }

.dgo__delete-btn {
  background: none;
  border: none;
  margin: 0;
  padding: 0;
  font-size: inherit;
  line-height: inherit;
  opacity: 0.2;
  cursor: pointer; }
  .dgo__delete-btn:hover, .dgo__delete-btn:focus, .dgo__delete-btn.focused {
    opacity: 1;
    color: #da5450;
    fill: #da5450; }

.dgo__admin-actions {
  margin-top: 2rem; }
  .dgo__admin-actions button {
    display: inline-block; }
    .dgo__admin-actions button + button {
      margin-left: 1rem; }

.dgo__story-plot path {
  stroke-dasharray: 2,1;
  fill: none; }

.dgo__story-plot circle {
  fill: #4b4a4b; }

.dgo__story-plot .reorderable {
  cursor: ns-resize; }

.dgo__story-plot .reorder-hint {
  opacity: 0;
  font-style: italic; }

.dgo__story-plot .action {
  cursor: pointer;
  font-style: italic; }
  .dgo__story-plot .action:hover {
    fill: #faa21b; }

.dgo__story-plot .response {
  font-style: normal; }

.dgo__story-plot .plot-element-label {
  font-weight: bold;
  text-transform: uppercase; }

.dgo__concept-web circle {
  fill: white; }

.dgo__concept-web .resize-preview {
  stroke: rgba(0, 0, 0, 0.5);
  stroke-width: 2;
  fill: rgba(255, 255, 255, 0.5); }

.dgo__concept-web .resize-handle {
  stroke: transparent;
  stroke-width: 15;
  fill: none; }

.dgo__concept-web .concept__header {
  font-weight: bold;
  text-transform: uppercase; }

.dgo__concept-web.editable .concept {
  cursor: pointer; }
  .dgo__concept-web.editable .concept circle, .dgo__concept-web.editable .concept text {
    -webkit-transition: fill 0.2s;
    -moz-transition: fill 0.2s;
    transition: fill 0.2s; }
  .dgo__concept-web.editable .concept:hover circle {
    fill: #f5f5f5; }
  .dgo__concept-web.editable .concept:hover text {
    fill: #faa21b; }

.dgo-flow-chart {
  display: flex;
  flex-direction: column; }
  .dgo-flow-chart .dgo-flow-chart__main, .dgo-flow-chart .dgo-flow-chart__other {
    border: 1px dotted #4b4a4b; }
  .dgo-flow-chart .dgo-flow-chart__main {
    height: 24rem; }
  .dgo-flow-chart .dgo-flow-chart__other {
    position: relative;
    flex: 1;
    height: 40rem;
    margin: 0 0.5rem; }
    .dgo-flow-chart .dgo-flow-chart__other-container {
      display: flex;
      flex-direction: row;
      list-style: none;
      margin: 0;
      padding: 0; }
    .dgo-flow-chart .dgo-flow-chart__other:first-child {
      margin-left: 0; }
    .dgo-flow-chart .dgo-flow-chart__other:last-child {
      margin-right: 0; }
    .dgo-flow-chart .dgo-flow-chart__other .dgo__delete-btn {
      position: absolute;
      bottom: 0;
      right: 0.5rem; }
  .dgo-flow-chart .dgo-flow-chart__arrows {
    position: relative; }
    .dgo-flow-chart .dgo-flow-chart__arrows:before {
      display: block;
      content: "";
      width: 100%;
      padding-top: 5%; }
    .dgo-flow-chart .dgo-flow-chart__arrows svg {
      position: absolute;
      top: 0;
      left: 0;
      right: 0;
      bottom: 0;
      width: 100%;
      height: 100%; }
      .dgo-flow-chart .dgo-flow-chart__arrows svg line, .dgo-flow-chart .dgo-flow-chart__arrows svg path {
        stroke: #4b4a4b; }
      .dgo-flow-chart .dgo-flow-chart__arrows svg line {
        stroke-dasharray: 1 1; }
      .dgo-flow-chart .dgo-flow-chart__arrows svg path {
        fill: #4b4a4b; }

.dgo-table {
  display: flex;
  flex-direction: row;
  list-style: none;
  margin: 0;
  padding: 0; }
  .dgo-table__cell {
    position: relative;
    flex: 1;
    height: 60rem;
    margin: 0 0.5rem;
    border: 1px dotted #4b4a4b; }
    .dgo-table__cell:first-child {
      margin-left: 0; }
    .dgo-table__cell:last-child {
      margin-right: 0; }
    .dgo-table__cell .dgo__delete-btn {
      position: absolute;
      bottom: 0;
      right: 0.5rem; }

.dgo-cause-and-effect {
  width: 100%; }
  .dgo-cause-and-effect textarea {
    resize: none;
    height: 20rem; }
  .dgo-cause-and-effect__table {
    border-collapse: separate;
    border-spacing: 2rem;
    margin: 0 -2rem 1rem;
    width: calc(100% + 4rem); }
  .dgo-cause-and-effect__header {
    text-transform: uppercase; }
    .dgo-cause-and-effect__header:focus {
      text-transform: none; }
  .dgo-cause-and-effect__cell {
    position: relative;
    border: 1px dotted #4b4a4b; }
    .dgo-cause-and-effect__cell ::-webkit-input-placeholder {
      font-style: italic; }
    .dgo-cause-and-effect__cell :-moz-placeholder {
      font-style: italic; }
    .dgo-cause-and-effect__cell ::-moz-placeholder {
      font-style: italic; }
    .dgo-cause-and-effect__cell :-ms-input-placeholder {
      font-style: italic; }
    .dgo-cause-and-effect__cell:first-child::after {
      position: absolute;
      left: 100%;
      top: calc(50% - 1rem);
      width: 2rem;
      height: 2rem;
      content: '';
      background: url('data:image/svg+xml;utf8,<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 20 20"><line stroke="%234b4a4b" stroke-dasharray="1 1" x1="0" y1="10" x2="18" y2="10" /><path fill="%234b4a4b" d="M 14 16 L 20 10 L 14 4 Z" /></svg>'); }
    .dgo-cause-and-effect__cell .dgo__delete-btn {
      position: absolute;
      left: 100%;
      top: 0;
      margin-left: 0.5rem; }

.dgo-stacked-sequence__list {
  list-style: none;
  margin: 0 0 2rem;
  padding: 0; }

.dgo-stacked-sequence__item {
  position: relative;
  height: 18rem;
  margin: 2rem 0;
  border: 1px dotted #4b4a4b; }
  .dgo-stacked-sequence__item:first-child {
    margin-top: 0; }
  .dgo-stacked-sequence__item:last-child {
    margin-bottom: 0; }
  .dgo-stacked-sequence__item + .dgo-stacked-sequence__item::before {
    position: absolute;
    bottom: 100%;
    left: calc(50% - 1rem);
    width: 2rem;
    height: 2rem;
    content: '';
    background: url('data:image/svg+xml;utf8,<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 20 20"><g transform="rotate(90 10 10)"><line stroke="%234b4a4b" stroke-dasharray="1 1" x1="0" y1="10" x2="18" y2="10" /><path fill="%234b4a4b" d="M 14 16 L 20 10 L 14 4 Z" /></g></svg>'); }
  .dgo-stacked-sequence__item textarea {
    height: 100%; }

.dgo-stacked-sequence .dgo__delete-btn {
  position: absolute;
  top: 0;
  right: 0;
  padding: 1rem; }

.dgo-venn__circle {
  stroke: #4b4a4b;
  fill: none; }

.dgo-venn__headers {
  display: flex; }
  .dgo-venn__headers.top .dgo-venn__header:first-child {
    text-align: left;
    padding: 0 1rem 0 0; }
    .dgo-venn__headers.top .dgo-venn__header:first-child button {
      text-align: left; }
  .dgo-venn__headers.top .dgo-venn__header:last-child {
    text-align: right;
    padding: 0 0 0 1rem; }
    .dgo-venn__headers.top .dgo-venn__header:last-child button {
      text-align: right; }
  .dgo-venn__headers.bottom {
    text-align: center; }
    .dgo-venn__headers.bottom button {
      text-align: center; }

.dgo-venn__header {
  flex: 1;
  font-weight: bold;
  text-transform: uppercase; }
  .dgo-venn__header h1, .dgo-venn__header h2, .dgo-venn__header h3, .dgo-venn__header h4, .dgo-venn__header h5, .dgo-venn__header h6 {
    font-weight: bold; }
  .dgo-venn__header button {
    border: none;
    padding: 0;
    background: transparent;
    font-weight: bold;
    text-transform: uppercase; }
    .dgo-venn__header button:hover {
      color: #faa21b; }
    .dgo-venn__header button.placeholder {
      font-style: italic; }

.dgo-venn .hover-region {
  cursor: pointer;
  stroke: none;
  fill: transparent; }

.dgo-venn .hover text {
  fill: #faa21b; }

.dgo-venn .hover .hover-region, .dgo-venn .focused .hover-region {
  fill: #00abe6;
  opacity: 0.05; }

.dgo-venn .dgo__delete-btn {
  font-size: 20px; }

.tab-mode-enabled .dgo__story-plot .focused .reorder-hint {
  opacity: 0.7; }

.droppable-overlay {
  -webkit-animation: none 0s;
  -moz-animation: none 0s;
  animation: none 0s;
  -webkit-transition: none;
  -moz-transition: none;
  transition: none;
  background: #ffffff;
  border: 1px solid #e1e1e1;
  border-radius: .5rem;
  box-shadow: 0 1px 3px 0 rgba(28, 28, 28, 0.1);
  position: absolute;
  z-index: 99;
  text-transform: none; }
  @media print {
    .droppable-overlay {
      display: none !important; } }
  .droppable-overlay:before {
    position: absolute;
    top: calc(-.75rem - 1px);
    left: 2.5rem;
    height: 1.5rem;
    width: 1.5rem;
    -webkit-transform: rotate(-45deg);
    -moz-transform: rotate(-45deg);
    -ms-transform: rotate(-45deg);
    -o-transform: rotate(-45deg);
    transform: rotate(-45deg);
    display: block;
    background: #ffffff;
    border: solid #e1e1e1;
    border-width: 1px 1px 0 0;
    content: ''; }
  .droppable-overlay.only-icon:before {
    left: 1rem !important; }
  .droppable-overlay--right {
    text-align: right; }
    .droppable-overlay--right:before {
      right: 2.5rem;
      left: auto; }
    .droppable-overlay--right.only-icon:before {
      right: 1rem !important;
      left: auto !important; }
    .droppable-overlay--right li > * {
      padding: .75rem 2rem .75rem 5rem !important; }
  .droppable-overlay.flipped:before {
    position: absolute;
    top: initial;
    bottom: -0.7rem;
    left: 2.5rem;
    border-width: 0 0 1px 1px; }
  .droppable-overlay ul {
    margin: 0;
    padding: 0;
    list-style: none;
    margin-top: 1rem;
    margin-bottom: 1rem;
    font-size: 1.5rem;
    line-height: 1.625; }
    .droppable-overlay ul::after {
      clear: both;
      content: "";
      display: table; }
    .droppable-overlay ul > li, .droppable-overlay ul > dd {
      margin: 0; }
    .droppable-overlay ul.long-list {
      max-height: 50vh;
      overflow-y: scroll; }
  .droppable-overlay li {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    display: block;
    margin-left: 0;
    white-space: nowrap; }
    .droppable-overlay li:hover {
      background: #f5f5f5; }
    .droppable-overlay li.header:hover {
      background: initial; }
    .droppable-overlay li > * {
      padding: .75rem 5rem .75rem 2rem; }
    .droppable-overlay li.droppable-spacer {
      border-bottom: 1px solid #e1e1e1; }
      .droppable-overlay li.droppable-spacer:hover {
        background: inherit; }
  .droppable-overlay a {
    display: block;
    color: #4b4a4b; }
    .droppable-overlay a:before {
      color: #faa21b;
      margin-right: .5rem; }
    .droppable-overlay a i {
      color: #4b4a4b !important; }

.droppable::after {
  font-family: "ss-icons";
  width: auto;
  margin: 0;
  font-style: normal;
  font-weight: normal;
  speak: none;
  display: inline-block;
  text-decoration: inherit;
  line-height: 1em;
  text-align: center;
  font-variant: normal;
  text-transform: none;
  vertical-align: middle;
  position: relative;
  top: -1px;
  text-rendering: optimizeLegibility;
  content: "";
  margin-left: .5rem;
  opacity: .5; }

.extq-gen-table table {
  width: 100%;
  margin: 1rem 0;
  border: 1px solid #b2b2b2;
  border-collapse: collapse;
  table-layout: fixed; }

.extq-gen-table th, .extq-gen-table td {
  padding: .75rem;
  border: 1px solid #e1e1e1;
  vertical-align: top; }
  .extq-gen-table th.remove, .extq-gen-table td.remove {
    width: 40px;
    text-align: center; }
  .extq-gen-table th.answer, .extq-gen-table td.answer {
    width: 100px; }

.extq-gen-table h5 {
  font-size: 1.5rem;
  line-height: 1.625;
  font-weight: 500;
  margin: 1rem 0; }
  .extq-gen-table h5:first-child {
    margin-top: 0; }
  .extq-gen-table h5:last-child {
    margin-bottom: 0; }

.extq-gen-table button {
  background: none;
  border: none;
  margin: 0;
  padding: 0;
  font-size: inherit;
  line-height: inherit; }

.extq-gen-table .btn {
  font-size: 1.6rem;
  line-height: 3.4rem;
  background-color: #fdb913;
  background-image: -webkit-linear-gradient(#fdb913, #faa21b);
  background-image: linear-gradient(#fdb913, #faa21b);
  display: inline-block;
  height: 3.4rem;
  padding: 0 23px;
  color: #ffffff !important;
  text-transform: none;
  border: none;
  vertical-align: middle;
  font-weight: 400;
  border-radius: .5rem;
  position: relative;
  /* Colors */
  background: transparent;
  border: 1px solid rgba(147, 149, 152, 0.5);
  color: #939598 !important;
  /* Size */
  padding-right: 15px;
  padding-left: 15px;
  font-size: 1.3rem;
  line-height: 30px;
  height: 30px;
  /* Icon */
  /* Mouse Actions */ }
  .extq-gen-table .btn[disabled] {
    opacity: .5; }
  .extq-gen-table .btn.loading {
    opacity: 1;
    color: rgba(255, 255, 255, 0) !important; }
  .extq-gen-table .btn[class*='icon']:before {
    margin-right: .5rem; }
  .extq-gen-table .btn:active {
    top: 1px; }

.extq-gen-table .redactor-layer {
  height: auto;
  padding: .75rem; }

.extq-gen-table .redactor-toolbar li a.re-button {
  height: auto;
  padding: .75rem; }

.extq-gen-table .selectize-control {
  margin-bottom: .75rem;
  width: 100%; }

.extq-gen-table .selectize-input {
  white-space: nowrap; }

.extq-gen-table .field + .field {
  margin-top: 4rem; }

.file-list {
  -webkit-columns: 1;
  -moz-columns: 1;
  columns: 1;
  margin: 0;
  padding: 0;
  list-style: none;
  margin: 1rem 0; }
  .file-list::after {
    clear: both;
    content: "";
    display: table; }
  .file-list > li, .file-list > dd {
    margin: 0; }
  .file-list:first-child {
    margin-top: 0; }
  .file-list:last-child {
    margin-bottom: 0; }
  @media (min-width: 768px) {
    .file-list {
      -webkit-columns: 2;
      -moz-columns: 2;
      columns: 2; } }
  @media (min-width: 1150px) {
    .file-list {
      -webkit-columns: 3;
      -moz-columns: 3;
      columns: 3; } }
  .file-list > li {
    position: relative;
    display: inline-block;
    width: 100%;
    margin-bottom: 1rem;
    -webkit-column-break-inside: avoid;
    page-break-inside: avoid;
    break-inside: avoid; }
    @media (max-width: 767px) {
      .file-list > li:last-child {
        margin-bottom: 0; } }
  .file-list a {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    font-size: 1.5rem;
    line-height: 1.3;
    padding: 1rem 4.5rem;
    display: block;
    border: 1px solid #e1e1e1;
    border-radius: 5px;
    color: #939598; }
    .file-list a:hover {
      border-color: #00abe6; }
      .file-list a:hover .file__icon {
        color: #00abe6; }
    @media (min-width: 768px) {
      .file-list a {
        overflow: hidden;
        text-overflow: ellipsis;
        white-space: nowrap; } }
  .file-list .file__icon {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    position: absolute;
    top: 50%;
    font-size: 1.5rem;
    line-height: 1.625;
    width: 5.5rem;
    left: 0;
    text-align: center;
    color: #00abe6;
    z-index: 1; }
    .file-list .file__icon--right {
      font-size: 1.9rem;
      line-height: 1.625;
      left: auto;
      right: 0;
      color: #e1e1e1; }
  .file-list .file__name {
    display: block;
    color: #00abe6;
    font-weight: 500; }
    @media (min-width: 768px) {
      .file-list .file__name {
        overflow: hidden;
        text-overflow: ellipsis;
        white-space: nowrap; } }
  .file-list .file__info {
    display: none; }
  .file-list--split {
    -webkit-columns: 1;
    -moz-columns: 1;
    columns: 1; }
    @media (min-width: 1150px) {
      .file-list--split {
        -webkit-columns: 2;
        -moz-columns: 2;
        columns: 2; } }
  .file-list--full {
    -webkit-columns: initial;
    -moz-columns: initial;
    columns: initial; }
  .file-list--expanded a {
    padding: 1.5rem 6.5rem; }
  .file-list--expanded .file__icon {
    width: 6.5rem;
    font-size: 3rem; }
    .file-list--expanded .file__icon--right {
      font-size: 2rem; }
  .file-list--expanded .file__info {
    display: block; }
  .file-list--compact {
    -webkit-columns: initial;
    -moz-columns: initial;
    columns: initial; }
    .file-list--compact li {
      margin: 0.5rem 0 0;
      width: 100%; }
      @media (min-width: 768px) {
        .file-list--compact li {
          margin: 0.7rem 1rem 0 0;
          width: auto; } }
    .file-list--compact a {
      font-size: 1.3rem;
      padding: 0.6rem 1.3rem 0.6rem 4.5rem; }
    .file-list--compact .file__icon {
      width: 4.5rem;
      font-size: 2.5rem; }
      @media (min-width: 768px) {
        .file-list--compact .file__icon--right {
          display: none; } }
    .file-list--compact .file__info {
      display: block; }
  .file-list--single .file__icon {
    line-height: 0; }
  .file-list--block > li {
    display: block; }

.flex-video {
  margin: 1rem 0;
  height: 0;
  padding-bottom: 56.25%;
  position: relative; }
  .flex-video:first-child {
    margin-top: 0; }
  .flex-video:last-child {
    margin-bottom: 0; }
  .flex-video iframe, .flex-video object, .flex-video embed {
    position: absolute;
    top: 0;
    left: 0;
    width: 100% !important;
    height: 100% !important; }

.fullscreen {
  position: fixed;
  top: 0;
  left: 0;
  width: 100%;
  height: 100vh;
  z-index: 9999; }
  .fullscreen::after {
    clear: both;
    content: "";
    display: table; }
  @media print {
    .fullscreen {
      position: static;
      height: auto; } }
  .fullscreen__left, .fullscreen__right {
    width: 50%;
    height: 100vh;
    overflow: scroll;
    padding: 3rem;
    background: #ffffff;
    position: relative;
    -webkit-overflow-scrolling: touch; }
    @media print {
      .fullscreen__left, .fullscreen__right {
        width: 100%;
        height: auto;
        overflow: auto; } }
  .fullscreen__left {
    -webkit-animation-name: slideInLeft;
    -moz-animation-name: slideInLeft;
    animation-name: slideInLeft;
    -webkit-animation-delay: 0;
    -moz-animation-delay: 0;
    animation-delay: 0;
    -webkit-animation-duration: 1s;
    -moz-animation-duration: 1s;
    animation-duration: 1s;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both;
    float: left; }
    .ng-leave .fullscreen__left {
      -webkit-animation-name: slideOutLeft;
      -moz-animation-name: slideOutLeft;
      animation-name: slideOutLeft;
      -webkit-animation-delay: 0.3s;
      -moz-animation-delay: 0.3s;
      animation-delay: 0.3s;
      -webkit-animation-duration: 1s;
      -moz-animation-duration: 1s;
      animation-duration: 1s;
      -webkit-animation-fill-mode: both;
      -moz-animation-fill-mode: both;
      animation-fill-mode: both; }
  .fullscreen__right {
    -webkit-animation-name: slideInRight;
    -moz-animation-name: slideInRight;
    animation-name: slideInRight;
    -webkit-animation-delay: 0;
    -moz-animation-delay: 0;
    animation-delay: 0;
    -webkit-animation-duration: 1s;
    -moz-animation-duration: 1s;
    animation-duration: 1s;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both;
    position: absolute;
    right: 0; }
    .ng-leave .fullscreen__right {
      -webkit-animation-name: slideOutRight;
      -moz-animation-name: slideOutRight;
      animation-name: slideOutRight;
      -webkit-animation-delay: 0.3s;
      -moz-animation-delay: 0.3s;
      animation-delay: 0.3s;
      -webkit-animation-duration: 1s;
      -moz-animation-duration: 1s;
      animation-duration: 1s;
      -webkit-animation-fill-mode: both;
      -moz-animation-fill-mode: both;
      animation-fill-mode: both; }
  .fullscreen__bar {
    -webkit-animation-name: fadeIn;
    -moz-animation-name: fadeIn;
    animation-name: fadeIn;
    -webkit-animation-delay: 1s;
    -moz-animation-delay: 1s;
    animation-delay: 1s;
    -webkit-animation-duration: 0.3s;
    -moz-animation-duration: 0.3s;
    animation-duration: 0.3s;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both;
    width: 0.3%;
    height: 100vh;
    background: #e1e1e1;
    cursor: col-resize;
    float: left;
    margin: 0 -0.15%;
    position: relative;
    z-index: 2; }
    .ng-leave .fullscreen__bar {
      background: transparent; }
  .fullscreen.ng-leave {
    -webkit-animation-name: fadeOut;
    -moz-animation-name: fadeOut;
    animation-name: fadeOut;
    -webkit-animation-delay: 0.3s;
    -moz-animation-delay: 0.3s;
    animation-delay: 0.3s;
    -webkit-animation-duration: 1s;
    -moz-animation-duration: 1s;
    animation-duration: 1s;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both; }
  .fullscreen [sticky].stuck {
    position: relative;
    top: auto !important; }

.full-screen-dialog {
  padding: 0; }
  .full-screen-dialog .ngdialog-overlay {
    display: none; }
  .full-screen-dialog .ngdialog-content {
    -webkit-animation-name: fadeIn;
    -moz-animation-name: fadeIn;
    animation-name: fadeIn;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both;
    position: absolute;
    top: 0;
    right: 0;
    bottom: 0;
    left: 0;
    height: 100%;
    width: 100%;
    max-width: none;
    max-height: none; }
  .full-screen-dialog [col-md] {
    width: 100%; }
    .full-screen-dialog [col-md] + [col-md] {
      margin-top: 3rem; }

body.fullscreen-open {
  overflow: hidden; }
  @media print {
    body.fullscreen-open {
      overflow: auto; } }
  body.fullscreen-open [ui-view=app] {
    -webkit-user-select: none;
    -moz-user-select: none;
    -ms-user-select: none;
    user-select: none; }

.gradebook .data-table .table__head {
  padding: 2rem 0; }

.gradebook .data-table .table__controls {
  margin-bottom: 0; }

.gradebook .ss-loader {
  margin-top: 25vh; }

.gradebook__table {
  overflow-x: scroll; }
  .gradebook__table::before {
    position: absolute;
    top: 0;
    left: 2.5rem;
    content: '';
    width: 10em;
    height: 21rem;
    background-image: linear-gradient(to left, rgba(255, 255, 255, 0), #ffffff);
    pointer-events: none;
    z-index: 1; }
  .gradebook__table::after {
    position: absolute;
    right: 2.5rem;
    bottom: 0;
    content: '';
    width: 10em;
    height: 100%;
    background-image: linear-gradient(to right, rgba(255, 255, 255, 0), #ffffff);
    pointer-events: none; }
  .gradebook__table table {
    font-size: 1.5rem;
    margin-top: 7rem;
    text-align: center; }

.gradebook__label::after {
  display: table-cell;
  content: '';
  width: 9.6rem;
  height: 100%;
  background-color: #f5f5f5;
  border-top: solid 1px #e1e1e1;
  border-left: solid 1px #e1e1e1; }

.gradebook__label th {
  padding: 0.5rem 1rem;
  border-top: solid 1px #e1e1e1;
  border-right: solid 1px #e1e1e1;
  font-weight: 400;
  width: 96px; }
  .gradebook__label th:first-child {
    position: relative;
    padding: 1.3rem 2rem;
    font-size: 1.2rem;
    min-width: 20rem;
    background: #f5f5f5;
    color: #939598;
    font-weight: 500;
    text-transform: uppercase;
    text-align: right;
    z-index: 2; }
  .gradebook__label th:last-child {
    border-right: none; }

.gradebook__label--rotate {
  height: 14rem;
  white-space: nowrap; }
  .gradebook__label--rotate::after {
    display: none; }
  .gradebook__label--rotate th {
    padding: 0;
    border: none; }
    .gradebook__label--rotate th:first-child {
      background-color: initial; }
    .gradebook__label--rotate th > div {
      -webkit-transform: translate(0, 9.6rem) rotate(315deg);
      -moz-transform: translate(0, 9.6rem) rotate(315deg);
      -ms-transform: translate(0, 9.6rem) rotate(315deg);
      -o-transform: translate(0, 9.6rem) rotate(315deg);
      transform: translate(0, 9.6rem) rotate(315deg);
      -webkit-transform-origin: 0% 0%;
      -moz-transform-origin: 0% 0%;
      -ms-transform-origin: 0% 0%;
      -o-transform-origin: 0% 0%;
      transform-origin: 0% 0%;
      width: 3rem; }
    .gradebook__label--rotate th div > div {
      padding: 2.3rem 0 0.3rem 6rem;
      overflow: hidden;
      text-overflow: ellipsis;
      white-space: nowrap;
      width: 30rem;
      border-top: solid 1px #e1e1e1;
      text-align: left;
      font-weight: 400; }
  .gradebook__label--rotate .rotate__empty div > div {
    padding-top: 5rem; }

.gradebook__label--student::after {
  height: 3.5rem;
  background-color: initial;
  border-left: solid 1px #f5f5f5; }

.gradebook__label--student th {
  border-right: solid 1px #f5f5f5;
  color: #939598;
  font-weight: 500;
  text-transform: uppercase; }
  .gradebook__label--student th:first-child {
    position: relative;
    font-size: 1.2rem;
    padding: 1rem 2rem 0.5rem;
    min-width: 20rem;
    background: #ffffff;
    color: #939598;
    font-weight: 500;
    text-transform: uppercase;
    text-align: left;
    z-index: 2; }
  .gradebook__label--student th:last-child {
    border-right: none; }

.gradebook__student::after {
  display: block;
  content: '';
  width: 9.6rem;
  height: 4.7rem;
  background-color: #f5f5f5;
  border-top: solid 1px #e1e1e1;
  border-left: solid 1px #e1e1e1; }

.gradebook__student .student__name {
  position: relative;
  padding: 1.1rem 2rem;
  min-width: 20rem;
  background: #f5f5f5;
  text-align: left;
  border-top: solid 1px #e1e1e1;
  border-right: solid 1px #e1e1e1;
  z-index: 2; }

.gradebook__student .student__grades {
  border-top: solid 1px #e1e1e1;
  border-right: solid 1px #e1e1e1; }
  .gradebook__student .student__grades:last-child {
    border-right: none; }
  .gradebook__student .student__grades a, .gradebook__student .student__grades .blank-score {
    padding: 1rem 2rem;
    display: block;
    box-sizing: border-box;
    width: 9.6rem;
    height: 4.6rem; }
  .gradebook__student .student__grades a {
    position: relative; }
    .gradebook__student .student__grades a:hover {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      border: solid 1px #faa21b; }
    .gradebook__student .student__grades a.icon-attention::before {
      position: absolute;
      left: 6px;
      top: 6px; }
  .gradebook__student .student__grades-blank {
    background-color: #f5f5f5; }

.gradebook__empty {
  margin-top: 20vh;
  text-align: center; }

[class*='headline'] {
  page-break-after: avoid;
  page-break-inside: avoid; }
  [class*='headline'] h1, [class*='headline'] h2, [class*='headline'] h3, [class*='headline'] h4, [class*='headline'] h5, [class*='headline'] h6 {
    font-size: inherit;
    line-height: inherit;
    margin: 0;
    font-weight: inherit; }
    [class*='headline'] h1 small, [class*='headline'] h2 small, [class*='headline'] h3 small, [class*='headline'] h4 small, [class*='headline'] h5 small, [class*='headline'] h6 small {
      float: right;
      line-height: inherit; }
    [class*='headline'] h1 [class*='icon-'], [class*='headline'] h2 [class*='icon-'], [class*='headline'] h3 [class*='icon-'], [class*='headline'] h4 [class*='icon-'], [class*='headline'] h5 [class*='icon-'], [class*='headline'] h6 [class*='icon-'] {
      color: #faa21b;
      opacity: 1; }
  @media (min-width: 768px) {
    [class*='headline'] .right, [class*='headline'] [dir-pagination-controls], [class*='headline'] [pagination-controls], [class*='headline'] dir-pagination-controls {
      float: right; } }
  [class*='headline'] i[class*='icon-'] {
    opacity: .5; }
  [class*='headline'] .logo {
    display: inline-block; }

.headline {
  position: relative;
  margin-bottom: 3rem;
  /* Sizes */
  /* Styles */ }
  .headline::after {
    clear: both;
    content: "";
    display: table; }
  .headline--xsmall {
    font-weight: 300;
    font-size: 1.4rem;
    line-height: 1.8rem; }
  .headline--small {
    font-weight: 300;
    font-size: 1.7rem;
    line-height: 1.8rem; }
  .headline--medium {
    font-weight: 400;
    font-size: 1.9rem;
    line-height: 2.2rem;
    margin-bottom: .5rem; }
  .headline--large {
    font-weight: 300;
    font-size: 2.4rem;
    line-height: 2.7rem; }
  .headline--xlarge {
    font-weight: 300;
    font-size: 2.6rem;
    line-height: 3.1rem; }
  .headline--xxlarge {
    font-weight: 300;
    font-size: 2.8rem;
    line-height: 3.2rem; }
  .headline--xxxlarge {
    font-weight: 300;
    font-size: 4rem;
    line-height: 1; }
    @media (min-width: 850px) {
      .headline--xxxlarge {
        font-size: 6rem;
        line-height: 1; } }
  .headline--hr {
    border-bottom: 1px solid #e1e1e1;
    margin-bottom: 2rem;
    padding-bottom: 1.2rem; }
  .headline--nohr {
    margin-bottom: 2em; }
  .headline--short-hr {
    border-bottom: 1px solid #EAE9ED;
    margin-bottom: 0;
    padding-bottom: 1.2rem; }
  .headline--strikethrough {
    position: relative;
    white-space: nowrap;
    text-align: center; }
    .headline--strikethrough:before {
      background: -webkit-linear-gradient( left , #f5f5f5 0, #e1e1e1 25%, #e1e1e1 75%, #f5f5f5 100%);
      background: linear-gradient(to right, #f5f5f5 0, #e1e1e1 25%, #e1e1e1 75%, #f5f5f5 100%);
      position: absolute;
      left: 0;
      top: .5em;
      width: 100%;
      height: 1px;
      content: ''; }
    .headline--strikethrough h1, .headline--strikethrough h2, .headline--strikethrough h3, .headline--strikethrough h4, .headline--strikethrough h5 {
      display: inline-block;
      padding: 0 1em;
      font-weight: 300;
      background: #ffffff;
      position: relative;
      top: -1px; }
    .headline--strikethrough span {
      font-size: 100%; }
  .headline--tall {
    padding-bottom: 1.2rem; }
  .headline--short {
    margin-bottom: 1rem; }
  .headline--thin {
    font-weight: 100; }
  .headline--bold {
    font-weight: bold; }
  .headline--extq {
    margin-bottom: .5rem; }
    .headline--extq p {
      display: inline-block;
      margin: 0; }
  .headline__details {
    padding: 0;
    list-style: none; }
    .headline__details::after {
      clear: both;
      content: "";
      display: table; }
    .headline__details > li, .headline__details > dd {
      margin: 0; }
    .headline__details li {
      font-size: 1.5rem;
      line-height: 1.625;
      color: #939598; }
  .headline__description {
    font-size: initial;
    font-style: italic; }

.sticky-headline [class*='headline'] {
  padding-top: 1.2rem; }

.home-features {
  padding-top: 0;
  padding-bottom: 0; }
  .home-features .features__nav {
    background: #fff; }
  .home-features .features__content {
    font-size: 1.6rem;
    line-height: 1.5;
    margin-top: 2.5rem;
    padding-bottom: 2rem;
    border-bottom: solid 1px #e1e1e1; }
    .home-features .features__content:last-child {
      border-bottom: none; }
    .home-features .features__content a {
      font-weight: 500; }
    .home-features .features__content .row:first-child {
      margin-bottom: 2rem; }
    .home-features .features__content .content__blasts {
      display: block; }
      .home-features .features__content .content__blasts::after {
        clear: both;
        content: "";
        display: table; }
      .home-features .features__content .content__blasts .blasts__thumb {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 100%; }
        .home-features .features__content .content__blasts .blasts__thumb:last-child {
          margin-right: 0; }
        @media (min-width: 768px) {
          .home-features .features__content .content__blasts .blasts__thumb {
            float: left;
            display: block;
            margin-right: 3.84615%;
            width: 48.07692%; }
            .home-features .features__content .content__blasts .blasts__thumb:last-child {
              margin-right: 0; } }
      .home-features .features__content .content__blasts .blasts__details {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 100%; }
        .home-features .features__content .content__blasts .blasts__details:last-child {
          margin-right: 0; }
        @media (min-width: 768px) {
          .home-features .features__content .content__blasts .blasts__details {
            float: left;
            display: block;
            margin-right: 3.84615%;
            width: 48.07692%; }
            .home-features .features__content .content__blasts .blasts__details:last-child {
              margin-right: 0; } }
    .home-features .features__content .content__ideas {
      display: block;
      margin: 0;
      padding: 0;
      list-style: none; }
      .home-features .features__content .content__ideas::after {
        clear: both;
        content: "";
        display: table; }
      .home-features .features__content .content__ideas::after {
        clear: both;
        content: "";
        display: table; }
      .home-features .features__content .content__ideas > li, .home-features .features__content .content__ideas > dd {
        margin: 0; }
      .home-features .features__content .content__ideas .ideas__list {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 100%;
        margin-bottom: 1rem; }
        .home-features .features__content .content__ideas .ideas__list:last-child {
          margin-right: 0; }
        @media (min-width: 768px) {
          .home-features .features__content .content__ideas .ideas__list {
            float: left;
            display: block;
            margin-right: 3.84615%;
            width: 48.07692%; }
            .home-features .features__content .content__ideas .ideas__list:last-child {
              margin-right: 0; }
            .home-features .features__content .content__ideas .ideas__list:nth-child(2n) {
              margin-right: 0; }
            .home-features .features__content .content__ideas .ideas__list:nth-child(2n+1) {
              clear: left; } }
    .home-features .features__content .content__link {
      display: block; }
    .home-features .features__content .content__thumb {
      background: center center no-repeat;
      background-size: cover;
      margin-bottom: 1.5rem;
      padding-bottom: 54%; }
    .home-features .features__content .content__headline, .home-features .features__content .content__prehead {
      display: block;
      color: #939598;
      font-weight: 500;
      margin-bottom: 1.5rem; }
      .home-features .features__content .content__headline i, .home-features .features__content .content__prehead i {
        color: #faa21b;
        margin-right: .25em; }
    .home-features .features__content .content__headline {
      font-weight: 400;
      font-size: 2.4rem;
      line-height: 2.7rem; }
      .home-features .features__content .content__headline i {
        opacity: 1; }
        .home-features .features__content .content__headline i.icon-nblasts {
          color: #9a488e; }
        .home-features .features__content .content__headline i.icon-nideas {
          color: #92af2b; }
        .home-features .features__content .content__headline i.icon-ngettingstarted {
          color: #ffdc19; }
    .home-features .features__content .content__prehead {
      font-size: inherit;
      line-height: inherit;
      margin-bottom: .5rem; }
    .home-features .features__content .content__title {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      font-size: 2.4rem;
      line-height: 1.2;
      color: #faa21b; }
      .home-features .features__content .content__title.large {
        font-size: 3rem;
        margin-top: .5rem; }
      .home-features .features__content .content__title a {
        font-weight: 400; }
    .home-features .features__content .content__desc {
      margin: .5rem 0; }

.home-masthead {
  padding-top: 2rem;
  padding-bottom: 2rem;
  background: #f5f5f5;
  border-bottom: 1px solid #e1e1e1;
  min-height: 8rem;
  margin-top: -2.5rem;
  position: relative;
  border: none; }
  .overlay .home-masthead, .home-masthead.previewMode, .embed-mode .home-masthead {
    margin-top: 0; }
  @media (min-width: 768px) {
    .home-masthead {
      min-height: 0;
      height: 0;
      padding: 0 0 22% 0;
      background: url("../img/home-hero.jpg") 0 -5vw no-repeat;
      background-size: cover; } }
  .home-masthead > .container {
    height: 100%; }
  @media (min-width: 768px) {
    .home-masthead .masthead__headline {
      -webkit-transform: translateY(9vw);
      -moz-transform: translateY(9vw);
      -ms-transform: translateY(9vw);
      -o-transform: translateY(9vw);
      transform: translateY(9vw); } }
  .home-masthead .masthead__headline h1, .home-masthead .masthead__headline h2, .home-masthead .masthead__headline h3, .home-masthead .masthead__headline h4, .home-masthead .masthead__headline h5, .home-masthead .masthead__headline h6 {
    font-size: 3.5rem;
    line-height: 1.1;
    font-weight: 200;
    text-align: center; }
    @media (min-width: 768px) {
      .home-masthead .masthead__headline h1, .home-masthead .masthead__headline h2, .home-masthead .masthead__headline h3, .home-masthead .masthead__headline h4, .home-masthead .masthead__headline h5, .home-masthead .masthead__headline h6 {
        font-size: 4.5vw; } }
  @media (min-width: 768px) {
    .home-masthead .masthead__headline--reviewer {
      -webkit-transform: translateY(12vw);
      -moz-transform: translateY(12vw);
      -ms-transform: translateY(12vw);
      -o-transform: translateY(12vw);
      transform: translateY(12vw); } }
  @media (min-width: 1264px) {
    .home-masthead .masthead__headline--reviewer h1, .home-masthead .masthead__headline--reviewer h2, .home-masthead .masthead__headline--reviewer h3, .home-masthead .masthead__headline--reviewer h4, .home-masthead .masthead__headline--reviewer h5, .home-masthead .masthead__headline--reviewer h6 {
      font-size: 3.5vw; } }
  .home-masthead .masthead__headline mark {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap;
    display: block;
    color: #f77e0d;
    font-size: 90%; }

.horz-icon-list {
  margin: 0;
  padding: 0;
  list-style: none;
  margin-top: 2rem;
  text-align: center; }
  .horz-icon-list::after {
    clear: both;
    content: "";
    display: table; }
  .horz-icon-list > li, .horz-icon-list > dd {
    margin: 0; }
  .horz-icon-list li {
    padding-right: 0.25rem;
    padding-left: 0.25rem;
    display: block;
    float: left;
    width: 20%; }
    @media (min-width: 768px) {
      .horz-icon-list li {
        padding-right: 1.4rem;
        padding-left: 1.4rem;
        display: inline-block;
        width: auto;
        float: none; } }
    @media (min-width: 1150px) {
      .horz-icon-list li {
        padding-right: 1.8rem;
        padding-left: 1.8rem; } }
  @media (max-width: 767px) {
    .horz-icon-list span {
      overflow: hidden;
      text-overflow: ellipsis;
      white-space: nowrap;
      display: block;
      font-size: 1.3rem; } }
  .horz-icon-list .icon {
    height: 3.55rem;
    width: 3.55rem; }
    @media (min-width: 768px) {
      .horz-icon-list .icon {
        height: 3.6rem;
        width: 3.6rem;
        -webkit-box-reflect: below 1px -webkit-linear-gradient(bottom, rgba(255, 255, 255, 0.3) 0%, transparent 60%, transparent 100%);
        margin-right: .5rem; } }

.hr {
  display: block;
  background: #e1e1e1;
  height: 1px;
  margin: 3rem 0;
  content: ''; }
  .hr--small {
    display: block;
    background: #e1e1e1;
    height: 1px;
    margin: 3rem 0;
    content: '';
    margin: 1rem 0; }

.divider {
  border-top: solid 1px #e1e1e1;
  margin-top: 2rem !important;
  padding-top: 2rem !important; }

[class^="icon-"]:before, [class*=" icon-"]:before {
  font-family: "ss-icons";
  width: auto;
  margin: 0;
  font-style: normal;
  font-weight: normal;
  speak: none;
  display: inline-block;
  text-decoration: inherit;
  line-height: 1em;
  text-align: center;
  font-variant: normal;
  text-transform: none;
  vertical-align: middle;
  position: relative;
  top: -1px;
  text-rendering: optimizeLegibility; }

i:first-child {
  margin-right: .2em; }

i:only-child {
  margin-right: 0; }

.indent {
  margin: 1rem 0 1rem 2rem; }
  .indent:first-child {
    margin-top: 0; }
  .indent:last-child {
    margin-bottom: 0; }

.inline-form-editable .editable-placeholder {
  color: #939598; }

.inline-form-editable .editable-click {
  position: relative;
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out; }
  .inline-form-editable .editable-click:hover {
    color: #faa21b;
    cursor: pointer; }
    .inline-form-editable .editable-click:hover::after {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      font-size: 2rem;
      line-height: 1;
      position: absolute;
      top: 50%;
      right: 0;
      -webkit-transform: translateY(-50%);
      -moz-transform: translateY(-50%);
      -ms-transform: translateY(-50%);
      -o-transform: translateY(-50%);
      transform: translateY(-50%);
      color: #faa21b; }

.inline-form-editable .editable-hide {
  display: none !important; }

.inline-form-editable .editable-input {
  background-color: transparent;
  line-height: 1; }

.inline-form-editable .editable-text .editable-controls, .inline-form-editable .editable-number .editable-controls, .inline-form-editable .editable-url .editable-controls {
  position: relative;
  display: block; }
  .inline-form-editable .editable-text .editable-controls .editable-input, .inline-form-editable .editable-number .editable-controls .editable-input, .inline-form-editable .editable-url .editable-controls .editable-input {
    width: 82%;
    margin: 0;
    padding: 0;
    border: none; }
  .inline-form-editable .editable-text .editable-controls [ng-click], .inline-form-editable .editable-number .editable-controls [ng-click], .inline-form-editable .editable-url .editable-controls [ng-click] {
    display: none; }

.inline-form-editable .editable-text .editable-buttons, .inline-form-editable .editable-number .editable-buttons, .inline-form-editable .editable-url .editable-buttons {
  position: absolute;
  top: 50%;
  right: 0;
  -webkit-transform: translateY(-50%);
  -moz-transform: translateY(-50%);
  -ms-transform: translateY(-50%);
  -o-transform: translateY(-50%);
  transform: translateY(-50%);
  margin: 0;
  line-height: .5rem; }
  .inline-form-editable .editable-text .editable-buttons button, .inline-form-editable .editable-number .editable-buttons button, .inline-form-editable .editable-url .editable-buttons button {
    font-size: 0;
    background-color: transparent;
    border: none; }
    .inline-form-editable .editable-text .editable-buttons button::before, .inline-form-editable .editable-number .editable-buttons button::before, .inline-form-editable .editable-url .editable-buttons button::before {
      font-size: 2rem;
      line-height: 1;
      color: #939598; }
    .inline-form-editable .editable-text .editable-buttons button:hover::before, .inline-form-editable .editable-number .editable-buttons button:hover::before, .inline-form-editable .editable-url .editable-buttons button:hover::before {
      color: #faa21b; }
    .inline-form-editable .editable-text .editable-buttons button[type="submit"]::before, .inline-form-editable .editable-number .editable-buttons button[type="submit"]::before, .inline-form-editable .editable-url .editable-buttons button[type="submit"]::before {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: ""; }
    .inline-form-editable .editable-text .editable-buttons button[type="button"]::before, .inline-form-editable .editable-number .editable-buttons button[type="button"]::before, .inline-form-editable .editable-url .editable-buttons button[type="button"]::before {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: ""; }

.inline-form-editable .editable-number .editable-controls .editable-input {
  width: 80%; }

.inline-form-editable .editable-textarea {
  background-color: #f5f5f5; }
  .inline-form-editable .editable-textarea .editable-buttons button {
    font-size: 1.6rem;
    line-height: 3.4rem;
    background-color: #fdb913;
    background-image: -webkit-linear-gradient(#fdb913, #faa21b);
    background-image: linear-gradient(#fdb913, #faa21b);
    display: inline-block;
    height: 3.4rem;
    padding: 0 23px;
    color: #ffffff !important;
    text-transform: none;
    border: none;
    vertical-align: middle;
    font-weight: 400;
    border-radius: .5rem;
    position: relative;
    /* Colors */
    /* Size */
    /* Icon */
    /* Mouse Actions */
    float: right;
    margin-top: 1rem;
    margin-bottom: 1rem;
    text-transform: capitalize; }
    .inline-form-editable .editable-textarea .editable-buttons button[disabled] {
      opacity: .5; }
    .inline-form-editable .editable-textarea .editable-buttons button.loading {
      opacity: 1;
      color: rgba(255, 255, 255, 0) !important; }
    .inline-form-editable .editable-textarea .editable-buttons button[class*='icon']:before {
      margin-right: .5rem; }
    .inline-form-editable .editable-textarea .editable-buttons button:active {
      top: 1px; }
    .inline-form-editable .editable-textarea .editable-buttons button::before {
      opacity: .5; }
    .inline-form-editable .editable-textarea .editable-buttons button[type="submit"] {
      margin-left: 1rem;
      background: #faa21b; }
      .inline-form-editable .editable-textarea .editable-buttons button[type="submit"]::before {
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: "";
        margin-right: .5rem; }
    .inline-form-editable .editable-textarea .editable-buttons button[type="button"] {
      background: transparent;
      border: 1px solid rgba(147, 149, 152, 0.5);
      color: #939598 !important; }
      .inline-form-editable .editable-textarea .editable-buttons button[type="button"]::before {
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: "";
        margin-right: .5rem; }
  .inline-form-editable .editable-textarea .redactor-toolbar {
    border-top: solid 1px #e1e1e1;
    border-right: solid 1px #e1e1e1;
    border-left: solid 1px #e1e1e1; }
  .inline-form-editable .editable-textarea .redactor-layer {
    max-height: none; }
    @media (min-width: 768px) {
      .inline-form-editable .editable-textarea .redactor-layer {
        height: initial;
        min-height: 10rem !important; } }

.inline-form-editable .editable-image {
  position: relative; }
  .inline-form-editable .editable-image .image__preview {
    position: relative;
    width: 100%;
    min-height: 18.7rem; }
  .inline-form-editable .editable-image .image__upload {
    position: absolute;
    top: 50%;
    right: 0;
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    width: 100%;
    text-align: center;
    color: #939598;
    border: solid 1px #e1e1e1;
    padding: 8rem 0; }
    .inline-form-editable .editable-image .image__upload::before {
      margin-right: .5rem; }
    .inline-form-editable .editable-image .image__upload:hover {
      color: #faa21b;
      border-color: #faa21b; }
  .inline-form-editable .editable-image .image__remove {
    position: absolute;
    top: 0.5rem;
    right: 0.5rem;
    font-size: 0;
    background-color: transparent;
    border: none; }
    .inline-form-editable .editable-image .image__remove::before {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      font-size: 2rem;
      line-height: 1;
      color: #e1e1e1; }
    .inline-form-editable .editable-image .image__remove:hover::before {
      color: #faa21b; }
  .inline-form-editable .editable-image img {
    cursor: default; }

.inline-form-editable .editable-assignment {
  position: relative; }
  @media (min-width: 768px) {
    .inline-form-editable .editable-assignment:hover .assignment__actions {
      display: inherit; } }
  .inline-form-editable .editable-assignment .assignment__preview {
    position: relative;
    width: 100%;
    min-height: 15rem; }
  .inline-form-editable .editable-assignment .assignment__create {
    position: absolute;
    top: 50%;
    right: 0;
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    width: 100%;
    text-align: center;
    color: #939598;
    border: solid 1px #e1e1e1;
    padding: 6.2rem 0; }
    .inline-form-editable .editable-assignment .assignment__create::before {
      margin-right: .5rem; }
    .inline-form-editable .editable-assignment .assignment__create:hover {
      color: #faa21b;
      border-color: #faa21b; }
  .inline-form-editable .editable-assignment .assignment__actions {
    position: absolute;
    top: 50%;
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    width: 100%;
    text-align: center;
    z-index: 1; }
    .inline-form-editable .editable-assignment .assignment__actions button:first-child {
      margin-top: 1rem; }
    @media (min-width: 768px) {
      .inline-form-editable .editable-assignment .assignment__actions {
        display: none; } }
    .inline-form-editable .editable-assignment .assignment__actions .btn--plain {
      background-color: #ffffff; }

.inline-form-editable .editable-draggable {
  padding: 2.5rem 2rem;
  -webkit-transform: translateY(-50%);
  -moz-transform: translateY(-50%);
  -ms-transform: translateY(-50%);
  -o-transform: translateY(-50%);
  transform: translateY(-50%);
  position: absolute;
  top: 50%;
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out;
  font-size: 2.1rem;
  left: 0;
  color: #e1e1e1;
  cursor: move;
  cursor: -webkit-grab; }
  .inline-form-editable .editable-draggable:before {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: "";
    color: inherit; }
  .inline-form-editable .editable-draggable:hover {
    color: #faa21b; }
  .inline-form-editable .editable-draggable:active {
    cursor: -webkit-grabbing; }

.inline-form-editable .editable-add {
  margin-top: 3rem; }

.inline-edit__display {
  position: relative;
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out; }
  .inline-edit__display:hover {
    color: #faa21b;
    cursor: pointer; }
    .inline-edit__display:hover::after {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      font-size: 2rem;
      line-height: 1;
      position: absolute;
      top: 50%;
      right: 0;
      -webkit-transform: translateY(-50%);
      -moz-transform: translateY(-50%);
      -ms-transform: translateY(-50%);
      -o-transform: translateY(-50%);
      transform: translateY(-50%);
      color: #faa21b; }

.inline-edit input {
  font-size: inherit;
  line-height: inherit;
  font-weight: 300; }

.inline-edit .editable-buttons::after {
  clear: both;
  content: "";
  display: table; }

.inline-edit .editable-buttons button {
  font-size: 1.6rem;
  line-height: 3.4rem;
  background-color: #fdb913;
  background-image: -webkit-linear-gradient(#fdb913, #faa21b);
  background-image: linear-gradient(#fdb913, #faa21b);
  display: inline-block;
  height: 3.4rem;
  padding: 0 23px;
  color: #ffffff !important;
  text-transform: none;
  border: none;
  vertical-align: middle;
  font-weight: 400;
  border-radius: .5rem;
  position: relative;
  /* Colors */
  /* Size */
  /* Icon */
  /* Mouse Actions */
  float: right;
  margin-top: 1rem;
  margin-bottom: 1rem;
  text-transform: capitalize; }
  .inline-edit .editable-buttons button[disabled] {
    opacity: .5; }
  .inline-edit .editable-buttons button.loading {
    opacity: 1;
    color: rgba(255, 255, 255, 0) !important; }
  .inline-edit .editable-buttons button[class*='icon']:before {
    margin-right: .5rem; }
  .inline-edit .editable-buttons button:active {
    top: 1px; }
  .inline-edit .editable-buttons button::before {
    opacity: .5; }
  .inline-edit .editable-buttons button[type="submit"] {
    margin-left: 1rem;
    background: #faa21b; }
    .inline-edit .editable-buttons button[type="submit"]::before {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      margin-right: .5rem; }
  .inline-edit .editable-buttons button[type="button"] {
    background: transparent;
    border: 1px solid rgba(147, 149, 152, 0.5);
    color: #939598 !important; }
    .inline-edit .editable-buttons button[type="button"]::before {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      margin-right: .5rem; }

.inline-edit .editable-placeholder {
  color: #939598; }

.inline-state-nav {
  font-size: 1.7rem;
  line-height: 1.625;
  margin: 0;
  padding: 0;
  list-style: none;
  border-bottom: 2px solid #e1e1e1;
  margin-bottom: 2.5rem; }
  .inline-state-nav::after {
    clear: both;
    content: "";
    display: table; }
  .inline-state-nav > li, .inline-state-nav > dd {
    margin: 0; }
  .inline-state-nav li {
    display: block;
    float: left;
    margin-bottom: -2px;
    border-bottom: 2px solid transparent; }
  .inline-state-nav a,
  .inline-state-nav button {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    display: block;
    padding: 1rem 2rem .75rem;
    color: #4b4a4b; }
    .inline-state-nav a:hover,
    .inline-state-nav button:hover {
      color: #1c1c1c; }
  .inline-state-nav .active {
    border-color: #faa21b; }
    .inline-state-nav .active, .inline-state-nav .active a {
      color: #1c1c1c; }
  .inline-state-nav--secondary .active {
    border-color: #00abe6; }
  .inline-state-nav--block {
    border: 1px solid #e1e1e1; }
    .inline-state-nav--block li {
      width: 100%;
      border-bottom: 1px solid #e1e1e1;
      margin-bottom: 0; }
      .inline-state-nav--block li:last-child {
        border-bottom: none; }
      @media (min-width: 768px) {
        .inline-state-nav--block li {
          width: initial;
          width: auto;
          border-right: 1px solid #e1e1e1;
          border-bottom: none; } }
      .inline-state-nav--block li button {
        -webkit-transition: all 0.15s ease-in-out;
        -moz-transition: all 0.15s ease-in-out;
        transition: all 0.15s ease-in-out;
        background: none;
        border: none;
        margin: 0;
        padding: 0;
        font-size: inherit;
        line-height: inherit;
        padding: 1rem 2.5rem;
        width: 100%;
        color: #4b4a4b; }
        .inline-state-nav--block li button:hover {
          color: #1c1c1c; }
        .inline-state-nav--block li button::before {
          opacity: .5;
          margin-right: .5rem; }
      .inline-state-nav--block li.active {
        background-color: #00abe6;
        border-color: #00abe6; }
        .inline-state-nav--block li.active button {
          color: #ffffff; }

.input {
  /* Helper */
  /* Standard Text Input */
  /* Clear for non-multi selectize */
  /* Toggle Switch */
  /* Rich Text */
  /* Range */ }
  .input__helper {
    font-size: 1.5rem;
    line-height: 1.4;
    display: block;
    font-style: italic;
    color: #939598;
    margin-top: 1rem; }
    .input__helper::before {
      margin-right: .5rem; }
  label .input__helper {
    margin-top: 0; }
  .input__text {
    position: relative; }
    .input__text .selectize-input,
    .input__text input,
    .input__text textarea {
      font-size: 1.5rem;
      line-height: 1em;
      background: #ffffff;
      border: none;
      padding: .9rem 0 .5rem;
      border-bottom: 2px solid #e1e1e1;
      border-radius: 0; }
      .input__text .selectize-input::placeholder,
      .input__text input::placeholder,
      .input__text textarea::placeholder {
        -webkit-transition: all 0.15s ease-in-out;
        -moz-transition: all 0.15s ease-in-out;
        transition: all 0.15s ease-in-out; }
      .input__text .selectize-input[disabled],
      .input__text input[disabled],
      .input__text textarea[disabled] {
        opacity: .5; }
    .input__text textarea {
      line-height: 1.6;
      min-height: 40px !important; }
    .input__text span[class*='icon']:not(.input__clear) {
      -webkit-transform: translateY(-50%);
      -moz-transform: translateY(-50%);
      -ms-transform: translateY(-50%);
      -o-transform: translateY(-50%);
      transform: translateY(-50%);
      position: absolute;
      top: 50%;
      top: calc(50% - 2px);
      left: .5rem;
      font-size: 85%;
      color: #939598;
      pointer-events: none; }
    .input__text[class*='icon']:not(.input__clear) input[type="color"], .input__text[class*='icon']:not(.input__clear) input[type="date"], .input__text[class*='icon']:not(.input__clear) input[type="datetime"], .input__text[class*='icon']:not(.input__clear) input[type="datetime-local"], .input__text[class*='icon']:not(.input__clear) input[type="email"], .input__text[class*='icon']:not(.input__clear) input[type="month"], .input__text[class*='icon']:not(.input__clear) input[type="number"], .input__text[class*='icon']:not(.input__clear) input[type="password"], .input__text[class*='icon']:not(.input__clear) input[type="search"], .input__text[class*='icon']:not(.input__clear) input[type="tel"], .input__text[class*='icon']:not(.input__clear) input[type="text"], .input__text[class*='icon']:not(.input__clear) input[type="time"], .input__text[class*='icon']:not(.input__clear) input[type="url"], .input__text[class*='icon']:not(.input__clear) input[type="week"], .input__text[class*='icon']:not(.input__clear) textarea {
      padding-left: 2.75rem; }
    .input__text[class*='icon']:not(.input__clear):before {
      -webkit-transform: translateY(-50%);
      -moz-transform: translateY(-50%);
      -ms-transform: translateY(-50%);
      -o-transform: translateY(-50%);
      transform: translateY(-50%);
      position: absolute;
      top: 50%;
      top: calc(50% - 2px);
      left: .5rem;
      font-size: 85%;
      color: #939598;
      pointer-events: none; }
    .input__text[class*='icon']:not(.input__clear).icon--right input[type="color"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="date"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="datetime"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="datetime-local"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="email"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="month"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="number"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="password"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="search"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="tel"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="text"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="time"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="url"], .input__text[class*='icon']:not(.input__clear).icon--right input[type="week"], .input__text[class*='icon']:not(.input__clear).icon--right textarea {
      padding-left: 0;
      padding-right: 2.75rem; }
    .input__text[class*='icon']:not(.input__clear).icon--right:before {
      left: auto;
      right: .5rem; }
    .input__text label {
      font-size: 1.5rem;
      line-height: 1.625;
      -webkit-transition: opacity 0.3s ease-in-out;
      -moz-transition: opacity 0.3s ease-in-out;
      transition: opacity 0.3s ease-in-out;
      position: absolute;
      top: -2rem;
      display: block;
      opacity: 0;
      color: #939598; }
    .input__text label + input,
    .input__text label ~ .selectize-control {
      margin-top: 2rem; }
    .input__text.has-value label {
      opacity: 1; }
  .input__clear {
    position: absolute;
    right: 6px;
    top: 3px;
    z-index: 999; }
  .input__switch label {
    display: flex !important; }
    .input__switch label .switch__toggle {
      -webkit-transition: border 0.25s 0.15s, box-shadow 0.25s 0.3s, padding 0.25s;
      -moz-transition: border 0.25s 0.15s, box-shadow 0.25s 0.3s, padding 0.25s;
      transition: border 0.25s 0.15s, box-shadow 0.25s 0.3s, padding 0.25s;
      display: block;
      background-color: #fafafa;
      border: 1px solid #e1e1e1;
      border-radius: 26px;
      box-shadow: inset 0 0 0 1px #e1e1e1;
      cursor: pointer;
      height: 28px;
      position: relative;
      min-width: 44px;
      vertical-align: top;
      content: ''; }
      .input__switch label .switch__toggle:after {
        position: absolute;
        top: 0;
        right: 16px;
        left: 0;
        -webkit-transition: border 0.25s 0.15s, left 0.25s 0.1s, right 0.15s 0.175s;
        -moz-transition: border 0.25s 0.15s, left 0.25s 0.1s, right 0.15s 0.175s;
        transition: border 0.25s 0.15s, left 0.25s 0.1s, right 0.15s 0.175s;
        background-color: #ffffff;
        border: 1px solid #e1e1e1;
        border-radius: 24px;
        box-shadow: inset 0 -3px 3px rgba(0, 0, 0, 0.025), 0 1px 4px rgba(0, 0, 0, 0.15), 0 4px 4px rgba(0, 0, 0, 0.1);
        content: '';
        display: block;
        height: 24px; }
    .input__switch label .switch__body {
      overflow: hidden;
      margin-left: 1.5rem; }
    .input__switch label input {
      position: absolute;
      visibility: hidden; }
    .input__switch label :checked + .switch__toggle {
      -webkit-transition: border 0.25s, box-shadow 0.25s, padding 0.25s 0.15s;
      -moz-transition: border 0.25s, box-shadow 0.25s, padding 0.25s 0.15s;
      transition: border 0.25s, box-shadow 0.25s, padding 0.25s 0.15s;
      border-color: #53d76a;
      box-shadow: inset 0 0 0 13px #53d76a;
      padding-left: 18px; }
      .input__switch label :checked + .switch__toggle:after {
        -webkit-transition: border 0.25s, left 0.15s 0.25s, right 0.25s 0.175s;
        -moz-transition: border 0.25s, left 0.15s 0.25s, right 0.25s 0.175s;
        transition: border 0.25s, left 0.15s 0.25s, right 0.25s 0.175s;
        border-color: #53d76a;
        left: 16px;
        right: 0; }
    .input__switch label .input__helper {
      margin: 0; }
  .input__richtext label {
    margin-bottom: 1.25rem; }
  .input__range {
    -webkit-appearance: none;
    width: 100%;
    margin: 6px 0; }
    .input__range:focus {
      outline: none; }
    .input__range::-webkit-slider-runnable-track {
      width: 100%;
      height: 4px;
      cursor: pointer;
      background: #939598; }
    .input__range::-webkit-slider-thumb {
      height: 16px;
      width: 16px;
      border-radius: 16px;
      background: #4b4a4b;
      cursor: pointer;
      -webkit-appearance: none;
      margin-top: -6px; }

input[type=text] {
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out; }
  input[type=text]:focus {
    border-color: #faa21b; }
  input[type=text]::-ms-clear {
    display: none; }

.unit-box {
  font-size: 1.6rem;
  line-height: 1.5;
  background: #f5f5f5;
  border-radius: 5px;
  padding: 2rem 2.5rem; }
  .unit-box__headline {
    font-size: 2.1rem;
    line-height: 1.2;
    margin-bottom: 2.5rem; }
  .unit-box .box__image, .unit-box .box__actions {
    display: block;
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0;
    float: right;
    clear: right; }
    .unit-box .box__image::after, .unit-box .box__actions::after {
      clear: both;
      content: "";
      display: table; }
    .unit-box .box__image:last-child, .unit-box .box__actions:last-child {
      margin-right: 0; }
    @media print {
      .unit-box .box__image, .unit-box .box__actions {
        float: left !important; } }
    @media (min-width: 768px) {
      .unit-box .box__image, .unit-box .box__actions {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 48.07692%;
        width: 50%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0;
        float: right; }
        .unit-box .box__image:last-child, .unit-box .box__actions:last-child {
          margin-right: 0; } }
  @media print and (min-width: 768px) {
    .unit-box .box__image, .unit-box .box__actions {
      float: left !important; } }
    @media (min-width: 1150px) {
      .unit-box .box__image, .unit-box .box__actions {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 39.42308%;
        width: 41.66667%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0;
        float: right; }
        .unit-box .box__image:last-child, .unit-box .box__actions:last-child {
          margin-right: 0; } }
  @media print and (min-width: 1150px) {
    .unit-box .box__image, .unit-box .box__actions {
      float: left !important; } }
  .unit-box .box__image {
    margin-bottom: 3rem; }
    @media (min-width: 768px) {
      .unit-box .box__image {
        margin-bottom: 0; } }
    .unit-box .box__image img {
      display: block; }
  .unit-box .box__body {
    display: block;
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0;
    float: left; }
    .unit-box .box__body::after {
      clear: both;
      content: "";
      display: table; }
    .unit-box .box__body:last-child {
      margin-right: 0; }
    @media print {
      .unit-box .box__body {
        float: left !important; } }
    @media (min-width: 768px) {
      .unit-box .box__body {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 48.07692%;
        width: 50%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0; }
        .unit-box .box__body:last-child {
          margin-right: 0; } }
  @media print and (min-width: 768px) {
    .unit-box .box__body {
      float: left !important; } }
    @media (min-width: 1150px) {
      .unit-box .box__body {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 56.73077%;
        width: 58.33333%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0; }
        .unit-box .box__body:last-child {
          margin-right: 0; } }
  @media print and (min-width: 1150px) {
    .unit-box .box__body {
      float: left !important; } }
  .unit-box .box__headline {
    font-size: 2.1rem;
    line-height: 1.2;
    font-weight: 500;
    margin-bottom: 1.5rem; }
  .unit-box .box__docs {
    list-style: none;
    padding-left: 0;
    clear: both; }
    .unit-box .box__docs li + li {
      margin-top: 3px; }
    .unit-box .box__docs .comma-separated-list {
      display: inline; }
  .unit-box .box__actions ul {
    margin: 0;
    padding: 0;
    list-style: none; }
    .unit-box .box__actions ul::after {
      clear: both;
      content: "";
      display: table; }
    .unit-box .box__actions ul > li, .unit-box .box__actions ul > dd {
      margin: 0; }
  .unit-box .box__actions li::after {
    clear: both;
    content: "";
    display: table; }
  .unit-box .box__actions a {
    display: block;
    width: 100%;
    text-align: center;
    margin-top: 1rem;
    float: left; }
    .unit-box .box__actions a:before {
      opacity: 1; }
    .unit-box .box__actions a.btn {
      padding-left: 0;
      padding-right: 0; }
  .unit-box .box__actions .actions__split a:first-child {
    border-bottom-right-radius: 0;
    border-top-right-radius: 0;
    width: 85%; }
  .unit-box .box__actions .actions__split a:last-child {
    border-bottom-left-radius: 0;
    border-top-left-radius: 0;
    width: 15%;
    border-left: 1px solid #ffffff; }
    .unit-box .box__actions .actions__split a:last-child:before {
      margin-right: 0; }
  .unit-box .box__actions .actions__split--evenly {
    display: flex; }
    .unit-box .box__actions .actions__split--evenly a:first-child, .unit-box .box__actions .actions__split--evenly a:last-child {
      width: 100%; }
  @media (max-width: 767px) {
    .unit-box.inline-form-editable {
      padding-left: 5rem; } }
  .unit-box.inline-form-editable .editable-draggable {
    left: -3.5rem; }
    @media (min-width: 768px) {
      .unit-box.inline-form-editable .editable-draggable {
        padding: 0 1rem;
        -webkit-transform: none;
        -moz-transform: none;
        -ms-transform: none;
        -o-transform: none;
        transform: none;
        top: -.3rem;
        left: 0; } }
  @media (min-width: 768px) {
    .unit-box.inline-form-editable .box__headline {
      width: 88%;
      margin-left: 2rem; } }
  @media (min-width: 1150px) {
    .unit-box.inline-form-editable .box__headline {
      width: 93%;
      margin-left: 2.5rem; } }
  .unit-box.inline-form-editable .box__headline .editable-click {
    overflow: hidden;
    text-overflow: ellipsis;
    white-space: nowrap; }
  .unit-box.inline-form-editable .box__headline input {
    font-size: 2.1rem;
    line-height: 1.2;
    font-weight: 500;
    height: 2.5rem; }
  .unit-box inline-form-overlay {
    display: inline-block; }
    .unit-box inline-form-overlay.editable-note-create a {
      color: #939598; }
      .unit-box inline-form-overlay.editable-note-create a::before {
        -webkit-transition: none;
        -moz-transition: none;
        transition: none;
        margin-right: .5rem; }
      .unit-box inline-form-overlay.editable-note-create a:hover {
        color: #faa21b; }

.unit-box + .unit-box {
  margin-top: 1.5rem; }

.link-list {
  margin: 0;
  padding: 0;
  list-style: none;
  font-weight: 500;
  color: #faa21b;
  position: relative; }
  .link-list::after {
    clear: both;
    content: "";
    display: table; }
  .link-list > li, .link-list > dd {
    margin: 0; }
  .link-list li {
    margin: 0;
    padding-left: .75em; }
    .link-list li:before {
      position: absolute;
      left: 0;
      content: '•'; }

.link-sections h5 {
  font-size: 1.4rem;
  line-height: 1.2;
  color: #1c1c1c;
  font-weight: 500;
  margin-top: 2rem; }
  @media (min-width: 1150px) {
    .link-sections h5:first-child {
      margin-top: 0; } }

.link-sections ul {
  margin: 0;
  padding: 0;
  list-style: none;
  margin-top: .5rem; }
  .link-sections ul::after {
    clear: both;
    content: "";
    display: table; }
  .link-sections ul > li, .link-sections ul > dd {
    margin: 0; }

@media (min-width: 1150px) {
  .link-sections .sections__bottom h5 {
    margin-top: 2rem; } }

.list-alt-rows {
  margin: 0;
  padding: 0;
  list-style: none;
  font-size: 1.5rem;
  line-height: 1.625; }
  .list-alt-rows::after {
    clear: both;
    content: "";
    display: table; }
  .list-alt-rows > li, .list-alt-rows > dd {
    margin: 0; }
  .list-alt-rows li {
    padding: 1rem; }
  .list-alt-rows li:nth-child(even) {
    background: #f5f5f5; }

.listing-view-select {
  float: right;
  font-size: 2.25rem; }
  @media (max-width: 767px) {
    .listing-view-select {
      display: none; } }
  .listing-view-select a {
    color: #939598; }
  .listing-view-select .active {
    color: #faa21b; }

.mackin-matches {
  margin: 0;
  padding: 0;
  list-style: none; }
  .mackin-matches::after {
    clear: both;
    content: "";
    display: table; }
  .mackin-matches > li, .mackin-matches > dd {
    margin: 0; }
  .mackin-matches li {
    display: inline-block;
    margin-right: 1rem; }

.module {
  display: block;
  padding-bottom: 3rem; }
  .module--small-only {
    margin-top: 0rem; }
    @media (max-width: 767px) {
      .module--small-only {
        margin-top: 3rem; } }
  .module--contained {
    border: 1px solid #e1e1e1;
    padding: 2.5rem;
    background: #f5f5f5;
    margin-bottom: 2.5rem; }
    .module--contained:first-child {
      margin-top: 0; }
    .module--contained:last-child {
      margin-bottom: 0; }
    .module--contained .headline {
      background: rgba(17, 17, 17, 0.4);
      margin: -2.5rem;
      margin-bottom: 2.5rem;
      padding: 1.25rem; }
      .module--contained .headline h2 {
        font-weight: 600;
        font-size: 1.9rem;
        line-height: 2.2rem;
        color: #fff;
        position: relative;
        padding-right: 3rem; }
        .module--contained .headline h2:before,
        .module--contained .headline h2 [class*='icon'] {
          position: absolute;
          top: auto;
          right: 0;
          bottom: auto;
          left: auto;
          font-size: 1.25em;
          color: #ffffff; }
        .module--contained .headline h2 svg.icon {
          -webkit-transform: translateY(-50%);
          -moz-transform: translateY(-50%);
          -ms-transform: translateY(-50%);
          -o-transform: translateY(-50%);
          transform: translateY(-50%);
          position: absolute;
          top: 50%;
          height: 3rem;
          width: 3rem;
          right: 0; }
        .module--contained .headline h2 button {
          background: none;
          border: none;
          margin: 0;
          padding: 0;
          font-size: inherit;
          line-height: inherit;
          line-height: 1em; }
      .module--contained .headline--green {
        background: #bfd730; }
      .module--contained .headline--blue {
        background: #00abe6; }
      .module--contained .headline--orange {
        background: #fdb913; }
      .module--contained .headline .assignment__tools {
        position: relative;
        z-index: 2;
        background: none;
        margin-top: -.6rem; }
    .module--contained .multitool__header {
      background-color: #f5f5f5; }
    .module--contained .file-list li {
      background: #ffffff; }
  .module--hr {
    border-top: 1px solid #e1e1e1;
    padding-top: 2rem; }
  .module--top {
    padding-top: 3rem; }
  .module--clear {
    clear: both; }
  .module--tight {
    padding-bottom: 1.5rem; }
  .module ol {
    margin-top: 0;
    margin-bottom: 2rem; }
    .module ol:last-of-type {
      margin-bottom: 0; }

.ngdialog {
  z-index: 1000; }
  @media print {
    .ngdialog {
      position: static; } }
  @media (min-width: 768px) {
    .ngdialog {
      padding: 10% 0; } }
  @media (min-width: 1150px) {
    .ngdialog {
      padding: 10rem 0; } }
  .ngdialog-overlay {
    height: 100%;
    overflow-y: auto; }
    .poster .ngdialog-overlay {
      background: rgba(255, 255, 255, 0.95); }
  .ngdialog-content {
    display: block;
    float: none !important;
    margin-left: auto !important;
    margin-right: auto !important;
    -webkit-animation-name: slideInDown;
    -moz-animation-name: slideInDown;
    animation-name: slideInDown;
    -webkit-animation-delay: 0;
    -moz-animation-delay: 0;
    animation-delay: 0;
    -webkit-animation-duration: 0.5s;
    -moz-animation-duration: 0.5s;
    animation-duration: 0.5s;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both;
    max-width: 970px;
    position: relative;
    max-height: none;
    overflow-y: visible; }
    @media (min-width: 768px) {
      .ngdialog-content {
        width: 65%;
        max-width: 60rem;
        max-height: none; } }
    .large .ngdialog-content {
      width: 100%;
      max-width: 100rem; }
      @media (min-width: 768px) {
        .large .ngdialog-content {
          width: 80%; } }
    .poster .ngdialog-content {
      -webkit-animation-name: fadeIn;
      -moz-animation-name: fadeIn;
      animation-name: fadeIn;
      -webkit-animation-delay: 0;
      -moz-animation-delay: 0;
      animation-delay: 0;
      -webkit-animation-duration: 0.3s;
      -moz-animation-duration: 0.3s;
      animation-duration: 0.3s;
      -webkit-animation-fill-mode: both;
      -moz-animation-fill-mode: both;
      animation-fill-mode: both;
      width: 100%;
      max-width: 1100px;
      background: none;
      max-height: 100%;
      overflow-y: hidden; }
    .ngdialog-content .redactor-editor {
      padding-top: 20px !important; }
    .ngdialog-content .redactor-toolbar {
      position: relative !important;
      visibility: visible !important;
      top: 0 !important; }
    .ngdialog-content.flowplayer-fullscreen {
      -webkit-animation-name: none;
      -moz-animation-name: none;
      animation-name: none;
      -webkit-animation-fill-mode: both;
      -moz-animation-fill-mode: both;
      animation-fill-mode: both; }
  .ngdialog-close {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    font-size: 3rem;
    line-height: 0;
    position: absolute;
    top: 1rem;
    right: 2.5rem;
    padding: 3.5rem 0 3.5rem 3.5rem;
    cursor: pointer;
    z-index: 2; }
    @media print {
      .ngdialog-close {
        display: none; } }
    @media (min-width: 1150px) {
      .ngdialog-close {
        right: 4rem; } }
    .ngdialog-close:before {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      font-size: 2rem;
      line-height: 1px;
      display: block;
      color: #939598; }
    .ngdialog-close:active {
      -webkit-transform: translateY(1px);
      -moz-transform: translateY(1px);
      -ms-transform: translateY(1px);
      -o-transform: translateY(1px);
      transform: translateY(1px); }

.cg-notify-message {
  background: #f5f8e9;
  border: 1px solid rgba(146, 175, 43, 0.5);
  color: #92af2b;
  padding: 1rem 1.5rem;
  border-radius: 3px;
  font-weight: 600;
  text-align: center; }

.notify--error {
  background: #fae5e5;
  border-color: rgba(218, 84, 80, 0.5);
  color: #da5450; }

.notify--info {
  background: #ffffb8;
  border-color: rgba(250, 162, 27, 0.5);
  color: #faa21b; }

.ng-show--fade {
  -webkit-transition: opacity 0.3s ease-in-out;
  -moz-transition: opacity 0.3s ease-in-out;
  transition: opacity 0.3s ease-in-out;
  opacity: 1; }
  .ng-show--fade.ng-hide {
    opacity: 0; }

[ng\:cloak], [ng-cloak], [data-ng-cloak], [x-ng-cloak], .ng-cloak, .x-ng-cloak {
  display: none !important; }

.ng-hide:not(.ng-animate) {
  display: none; }

[ng-if], [ng-repeat] {
  -webkit-animation: none 0s;
  -moz-animation: none 0s;
  animation: none 0s; }

.ng-show--slide-down {
  -webkit-transition: max-height 0.4s ease-in-out;
  -moz-transition: max-height 0.4s ease-in-out;
  transition: max-height 0.4s ease-in-out;
  max-height: none;
  overflow: hidden; }
  .ng-show--slide-down.ng-hide-remove, .ng-show--slide-down.ng-hide.ng-hide-add-active {
    max-height: 0; }
  .ng-show--slide-down.ng-hide-add, .ng-show--slide-down.ng-hide-remove-active {
    max-height: 80vh; }

ng-include {
  display: block; }

[ng-click] {
  cursor: pointer; }

.number-crunch {
  text-align: center; }
  .number-crunch .number-crunch__question {
    margin: -2.5rem -2.5rem 0;
    font-size: 4rem;
    line-height: 1.2em;
    background: #ffffff;
    padding: 1.5rem 2.5rem; }
    @media (min-width: 850px) {
      .number-crunch .number-crunch__question {
        font-size: 4.5rem; } }
  .number-crunch .number-crunch__answer {
    margin: 0 -2.5rem -2.5rem;
    padding: 2.5rem;
    background: #f5f5f5;
    position: relative; }
    .number-crunch .number-crunch__answer span {
      -webkit-transition: opacity 0.3s ease-in-out;
      -moz-transition: opacity 0.3s ease-in-out;
      transition: opacity 0.3s ease-in-out;
      display: block;
      opacity: 0;
      min-height: 2em; }
    .number-crunch .number-crunch__answer.active span {
      opacity: 1; }
  .number-crunch__icon {
    font-size: 5rem;
    line-height: 1;
    -webkit-transition: opacity 0.15s ease-in-out;
    -moz-transition: opacity 0.15s ease-in-out;
    transition: opacity 0.15s ease-in-out;
    position: absolute;
    top: 50%;
    left: 50%;
    margin: -2.5rem 0 0 -2.5rem;
    cursor: pointer;
    z-index: 1; }
    @media (min-width: 1150px) {
      .number-crunch__icon {
        font-size: 7rem;
        margin: -3.5rem 0 0 -3.5rem; } }
    .number-crunch__icon.ng-hide {
      opacity: 0; }

@media (min-width: 1150px) {
  .overlay__head > .container, .overlay__body > .container, .overlay__footer > .container {
    padding-right: 4rem;
    padding-left: 4rem; } }

.overlay__head, .overlay__footer {
  padding: 3rem 0; }

.overlay__head .headline {
  margin-bottom: 0;
  text-align: center; }

.overlay__body {
  padding: 0 0 3rem 0; }
  @media (max-width: 767px) {
    .overlay__body .btn {
      margin-bottom: 1rem;
      display: block;
      margin-left: 0 !important; } }
  .overlay__body .inline-form-editable .headline {
    margin-top: -3rem; }
  .overlay__body .inline-form-editable .ss-form {
    margin-top: -4rem; }
    .overlay__body .inline-form-editable .ss-form input {
      font-weight: 300;
      font-size: 2.8rem;
      line-height: 3.2rem;
      width: 95%;
      padding-bottom: 2rem;
      border: none; }
    .overlay__body .inline-form-editable .ss-form label {
      display: none; }
    .overlay__body .inline-form-editable .ss-form .row {
      margin-bottom: 0; }
  .overlay__body .extq__draggables li {
    padding-left: 1rem; }
    .overlay__body .extq__draggables li:before {
      display: none; }
  .overlay__body .extq__draggables-image {
    transform: none !important; }
  .overlay__body .total-note {
    font-size: 1.5rem;
    color: #4b4a4b; }
  .overlay__body .login-stats-list {
    margin: 0;
    padding: 0;
    list-style: none;
    padding: 1rem 0; }
    .overlay__body .login-stats-list::after {
      clear: both;
      content: "";
      display: table; }
    .overlay__body .login-stats-list > li, .overlay__body .login-stats-list > dd {
      margin: 0; }
    .overlay__body .login-stats-list__stat {
      text-align: center; }
      .overlay__body .login-stats-list__stat--text-left {
        text-align: left; }
      .overlay__body .login-stats-list__stat--header {
        text-align: center;
        font-size: 2.0rem;
        font-weight: 500; }
    .overlay__body .login-stats-list .hr {
      margin: 1rem 0; }
  .overlay__body .usage-stats {
    display: flex;
    justify-content: space-around;
    align-items: baseline;
    align-content: center;
    margin: 0 auto;
    padding: 1rem 0; }
    .overlay__body .usage-stats__item {
      flex: 0 1 auto; }
      .overlay__body .usage-stats__item .hr {
        margin: 0.5rem 0; }
    .overlay__body .usage-stats__list {
      margin: 0;
      padding: 0;
      list-style: none;
      padding: 1rem 0; }
      .overlay__body .usage-stats__list::after {
        clear: both;
        content: "";
        display: table; }
      .overlay__body .usage-stats__list > li, .overlay__body .usage-stats__list > dd {
        margin: 0; }
    .overlay__body .usage-stats__list-item {
      padding-left: 1rem;
      font-size: 1.5rem;
      color: #4b4a4b; }
      .overlay__body .usage-stats__list-item:before {
        display: none; }

.overlay__actions {
  margin-top: 3rem; }
  .overlay__actions::after {
    clear: both;
    content: "";
    display: table; }
  .overlay__actions button {
    margin-right: 1rem; }
    .overlay__actions button:first-child {
      float: left; }
    .overlay__actions button:last-of-type {
      float: right; }
  .overlay__actions.reversed button:last-child {
    float: left; }
  .overlay__actions.reversed button:first-child {
    float: right; }

.overlay .logo {
  display: block; }
  .overlay .logo img {
    margin: 0 auto; }

.overlay .table__head {
  padding-top: 0; }

.overlay .table__actions {
  text-align: center; }

.overlay canvas {
  width: 100%; }

.page-header {
  padding-top: 2rem;
  padding-bottom: 2rem;
  background: #f5f5f5;
  border-bottom: 1px solid #e1e1e1;
  min-height: 8rem;
  margin-top: -2.5rem; }
  .overlay .page-header, .page-header.previewMode, .embed-mode .page-header {
    margin-top: 0; }
  .page-header .header__upper {
    position: relative; }
    .page-header .header__upper::after {
      clear: both;
      content: "";
      display: table; }
  .page-header .header__lower {
    margin-top: 3rem; }
  .page-header .header__subhead h1, .page-header .header__subhead h2, .page-header .header__subhead h3, .page-header .header__subhead h4, .page-header .header__subhead h5, .page-header .header__subhead h6 {
    font-size: 1.9rem;
    line-height: 1.3;
    color: rgba(28, 28, 28, 0.5); }
  .page-header .header__headline {
    font-size: 3rem;
    line-height: 1.3;
    font-weight: 300; }
    @media (min-width: 768px) {
      .page-header .header__headline {
        width: inherit;
        max-width: 55rem;
        float: left; } }
    @media (min-width: 1150px) {
      .page-header .header__headline {
        max-width: 68rem; } }
    .page-header .header__headline p {
      font-size: 1.5rem;
      line-height: 1.6;
      margin-top: 0;
      font-weight: 300; }
  .page-header .header__subhead + .header__headline {
    font-weight: 500; }
  .page-header .header__actions {
    margin-top: 1rem; }
    @media (min-width: 768px) {
      .page-header .header__actions {
        -webkit-transform: translateY(-50%);
        -moz-transform: translateY(-50%);
        -ms-transform: translateY(-50%);
        -o-transform: translateY(-50%);
        transform: translateY(-50%);
        position: absolute;
        top: 50%;
        right: 0;
        margin-top: 0; } }
    .page-header .header__actions .icon-angle-left::before {
      margin-right: 1rem; }
    .page-header .header__actions .icon-angle-right::before {
      content: ""; }
    .page-header .header__actions .icon-angle-right::after {
      font-family: "ss-icons";
      content: '\e83e';
      margin-left: 1rem; }
  .page-header .header__details::after {
    clear: both;
    content: "";
    display: table; }
  .page-header .header__details .details__section {
    font-size: 1.5rem;
    line-height: 1.625; }
    @media (min-width: 768px) {
      .page-header .header__details .details__section {
        float: left;
        margin-left: 3rem; } }
    @media (min-width: 1150px) {
      .page-header .header__details .details__section {
        display: inline;
        margin-left: 7rem; } }
    .page-header .header__details .details__section:first-child {
      margin-left: 0; }
    .page-header .header__details .details__section a {
      color: #4b4a4b; }
      .page-header .header__details .details__section a:hover {
        color: #faa21b; }
      .page-header .header__details .details__section a::before {
        margin-right: .5rem;
        color: #faa21b; }
    .page-header .header__details .details__section th {
      text-align: left;
      font-weight: 300;
      color: #939598;
      padding-right: 2rem; }
    @media (max-width: 767px) {
      .page-header .header__details .details__section tr {
        display: block;
        padding-top: 1.4rem; } }
    @media (min-width: 768px) {
      .page-header .header__details .details__section tr + tr th, .page-header .header__details .details__section tr + tr td {
        padding-top: 1.4rem; } }
    .page-header .header__details .details__section.section--vertical {
      display: block;
      margin-right: 7rem; }
      .page-header .header__details .details__section.section--vertical th, .page-header .header__details .details__section.section--vertical td {
        display: block; }
      .page-header .header__details .details__section.section--vertical td {
        padding: 0; }
      .page-header .header__details .details__section.section--vertical tr + tr th {
        padding-top: .5rem; }

.pagination {
  margin: 0;
  padding: 0;
  list-style: none;
  display: -webkit-box;
  display: -moz-box;
  display: box;
  display: -webkit-flex;
  display: -moz-flex;
  display: -ms-flexbox;
  display: flex;
  -webkit-box-pack: justify;
  -moz-box-pack: justify;
  box-pack: justify;
  -webkit-justify-content: space-between;
  -moz-justify-content: space-between;
  -ms-justify-content: space-between;
  -o-justify-content: space-between;
  justify-content: space-between;
  -ms-flex-pack: justify;
  width: 100%;
  height: 2.4rem;
  position: relative; }
  .pagination > li, .pagination > dd {
    margin: 0; }
  @media (max-width: 767px) {
    .pagination {
      margin-bottom: 2rem; } }
  .pagination:before {
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    position: absolute;
    width: 100%;
    height: .5rem;
    left: 0;
    top: 50%;
    background: #e1e1e1;
    content: '';
    z-index: 0; }
    @media (min-width: 768px) {
      .pagination:before {
        display: none; } }
  .pagination li {
    background: #ffffff;
    padding: 0 2px;
    position: relative; }
    @media (min-width: 768px) {
      .pagination li {
        margin-left: 2px; } }
  .pagination a {
    height: 2.4rem;
    width: 2.4rem;
    font-size: 1.5rem;
    line-height: 2.6rem;
    display: block;
    background: #e1e1e1;
    color: #ffffff;
    border-radius: 50%;
    text-align: center;
    font-weight: 600; }
  .pagination .active a {
    background: #00abe6; }
    @media (max-width: 767px) {
      .pagination .active a {
        border-radius: 2px; }
        .pagination .active a:after {
          height: 0;
          width: 0;
          -webkit-transform: translate(-50%, 100%);
          -moz-transform: translate(-50%, 100%);
          -ms-transform: translate(-50%, 100%);
          -o-transform: translate(-50%, 100%);
          transform: translate(-50%, 100%);
          position: absolute;
          bottom: 0;
          left: 50%;
          width: 0;
          border: solid transparent;
          border-width: .9rem 1.1rem 0 1.1rem;
          border-top-color: #00abe6;
          content: ''; } }
  .pagination__picker {
    margin: 2rem auto; }
    @media (min-width: 768px) {
      .pagination__picker {
        justify-content: center; } }
    @media (min-width: 768px) {
      .pagination__picker li {
        margin-left: .5rem;
        margin-right: .5rem; } }

.poll-results {
  margin: 0;
  padding: 0;
  list-style: none; }
  .poll-results::after {
    clear: both;
    content: "";
    display: table; }
  .poll-results > li, .poll-results > dd {
    margin: 0; }
  .poll-results li, .poll-results li + li {
    display: flex;
    flex-direction: row;
    margin-top: 1em; }
  .poll-results p {
    margin-top: 0;
    margin-bottom: 0; }
  .poll-results__color {
    height: 20px;
    width: 20px;
    flex: 0 0 20px;
    margin-right: 10px;
    position: relative;
    top: .25rem; }
  .poll-results__vote-percent {
    flex: 0 0 50px;
    margin-left: 10px;
    font-weight: bold;
    font-size: smaller;
    text-align: right; }
  .poll-results__option {
    overflow: hidden;
    flex: 1 0 0; }

.print-forbidden {
  -webkit-user-select: none !important;
  -moz-user-select: none !important;
  -ms-user-select: none !important;
  user-select: none !important; }
  @media print {
    .print-forbidden {
      visibility: hidden;
      height: 2em;
      overflow: hidden; } }
  @media print {
    .print-forbidden:before {
      content: attr(print-forbidden-message);
      visibility: visible;
      line-height: 2em; } }

.rating__numeric {
  font-weight: 300;
  font-size: 2.4rem;
  line-height: 2.7rem;
  margin: 0;
  padding-top: .5rem;
  float: right;
  font-weight: 600; }

.rating__options {
  margin: 0;
  padding: 0;
  list-style: none;
  font-size: 3rem;
  line-height: 1em; }
  .rating__options::after {
    clear: both;
    content: "";
    display: table; }
  .rating__options > li, .rating__options > dd {
    margin: 0; }
  .rating__options li {
    display: inline-block; }
  .rating__options li + li {
    margin-left: 3px; }

.rating--input {
  cursor: pointer; }

.rating--small {
  font-size: 20px; }

.rating--stars li:before {
  font-family: "ss-icons";
  width: auto;
  margin: 0;
  font-style: normal;
  font-weight: normal;
  speak: none;
  display: inline-block;
  text-decoration: inherit;
  line-height: 1em;
  text-align: center;
  font-variant: normal;
  text-transform: none;
  vertical-align: middle;
  position: relative;
  top: -1px;
  text-rendering: optimizeLegibility;
  content: "";
  color: #bfd730; }

.rating--stars .half:before {
  font-family: "ss-icons";
  content: ""; }

.rating--stars .active:before {
  font-family: "ss-icons";
  content: ""; }

.rating--blocks li {
  position: relative; }
  .rating--blocks li > * {
    pointer-events: none; }
  .rating--blocks li:before {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: "";
    height: 1.5rem;
    width: 1.5rem;
    position: absolute;
    top: 0.2em;
    left: 0;
    display: block;
    border: 1px solid #4b4a4b;
    border-radius: 3px;
    color: rgba(28, 28, 28, 0);
    padding: .2rem;
    font-size: 1rem; }
  .rating--blocks li:before {
    content: '';
    background: rgba(146, 175, 43, 0); }
  .rating--blocks li:hover:before {
    border-color: #faa21b;
    background-clip: content-box; }
  .rating--blocks li:before {
    position: relative; }
  .rating--blocks li.active:before {
    background-color: #92af2b;
    border-color: #4b4a4b; }
    @media print {
      .rating--blocks li.active:before {
        background-color: #C0C3C7 !important;
        -webkit-print-color-adjust: exact; } }
  .rating--blocks li.active:hover::before {
    border-color: #faa21b; }
  .rating--blocks li.active:hover:before {
    border: 1px solid #faa21b; }
  .rating--blocks li.active.zero::before {
    background: #939598; }
  .rating--blocks li.zero::before {
    background: #ffffff;
    margin-right: 1rem;
    border: 1px solid #4b4a4b; }
  .rating--blocks li.zero:focus::before, .rating--blocks li.zero:hover::before {
    background: #939598;
    border-color: #faa21b;
    background-clip: content-box; }

.rating--blocks li + li {
  margin-left: .25em; }

[read-only] .rating--input {
  cursor: initial; }

[read-only] .rating--blocks {
  pointer-events: none; }

.redactor__counts {
  font-size: 1.3rem;
  line-height: 1.625;
  margin-top: .5rem;
  float: right; }

.redactor__autosave {
  font-size: 1.3rem;
  line-height: 1.625;
  margin-top: .5rem;
  float: left; }

.redactor__instructions {
  background: none;
  border: none;
  margin: 0;
  padding: 0;
  font-size: inherit;
  line-height: inherit;
  font-size: 1.9rem;
  line-height: 1.625;
  position: absolute;
  right: 1rem;
  bottom: 0;
  padding: 0 1rem;
  margin-bottom: 1rem;
  z-index: 101;
  color: #939598; }

.redactor-styles {
  font-family: "ProximaNova", -apple-system, sans-serif;
  font-weight: 400; }
  .redactor-styles .indent {
    margin: 16px 0 16px 2rem; }
    .redactor-styles .indent:first-child {
      margin-top: 0; }
    .redactor-styles .indent:last-child {
      margin-bottom: 0; }
  .redactor-styles .flex-video {
    margin: 16px 0; }
    .redactor-styles .flex-video:first-child {
      margin-top: 0; }
    .redactor-styles .flex-video:last-child {
      margin-bottom: 0; }

.redactor-toolbar {
  background: #f5f5f5;
  box-shadow: none; }
  .redactor-toolbar li a {
    color: rgba(28, 28, 28, 0.6); }
    .redactor-toolbar li a:hover {
      background: none;
      color: #1c1c1c; }
    .redactor-toolbar li a.redactor-act {
      background: #939598;
      color: #ffffff; }
    .redactor-toolbar li a.re-button-icon {
      padding: 1.5rem; }
  .redactor-toolbar i {
    margin: 0; }

.redactor-layer {
  padding: 2rem 2rem 4rem;
  max-height: 30rem;
  overflow: auto; }
  @media (min-width: 768px) {
    .redactor-layer {
      height: 40rem; } }
  .redactor-layer.redactor--expand {
    max-height: none; }
    @media (min-width: 768px) {
      .redactor-layer.redactor--expand {
        height: initial;
        min-height: 20rem !important; } }

.redactor-box .re-ssAutosaveConflict {
  color: #da5450; }

.redactor-layer, .redactor-box, .redactor-box textarea {
  z-index: 50; }

#redactor-modal {
  font-family: "ProximaNova", -apple-system, sans-serif;
  font-weight: 400;
  border-radius: 0; }
  #redactor-modal section {
    padding: 0; }
  #redactor-modal label input {
    display: initial; }
  #redactor-modal #redactor-modal-header {
    display: none; }
  #redactor-modal #redactor-modal-body {
    font-size: 1.7rem;
    line-height: 1.625;
    padding: 0; }
    #redactor-modal #redactor-modal-body .definition {
      float: right; }
  #redactor-modal #redactor-modal-button-cancel, #redactor-modal #redactor-modal-button-action {
    font-size: 1.6rem;
    line-height: 3.4rem;
    background-color: #fdb913;
    background-image: -webkit-linear-gradient(#fdb913, #faa21b);
    background-image: linear-gradient(#fdb913, #faa21b);
    display: inline-block;
    height: 3.4rem;
    padding: 0 23px;
    color: #ffffff !important;
    text-transform: none;
    border: none;
    vertical-align: middle;
    font-weight: 400;
    border-radius: .5rem;
    position: relative;
    /* Colors */
    /* Size */
    /* Icon */
    /* Mouse Actions */
    font-family: "ProximaNova", -apple-system, sans-serif;
    font-weight: 400; }
    #redactor-modal #redactor-modal-button-cancel[disabled], #redactor-modal #redactor-modal-button-action[disabled] {
      opacity: .5; }
    #redactor-modal #redactor-modal-button-cancel.loading, #redactor-modal #redactor-modal-button-action.loading {
      opacity: 1;
      color: rgba(255, 255, 255, 0) !important; }
    #redactor-modal #redactor-modal-button-cancel[class*='icon']:before, #redactor-modal #redactor-modal-button-action[class*='icon']:before {
      margin-right: .5rem; }
    #redactor-modal #redactor-modal-button-cancel:active, #redactor-modal #redactor-modal-button-action:active {
      top: 1px; }
  #redactor-modal #redactor-modal-button-cancel {
    background: transparent;
    border: 1px solid rgba(147, 149, 152, 0.5);
    color: #939598 !important; }
  #redactor-modal #redactor-modal-button-action {
    background-color: #faa21b !important; }
  #redactor-modal #redactor-modal-close {
    position: absolute;
    top: 2.5rem;
    right: 2.5rem;
    font-size: 0;
    margin: 0;
    z-index: 1; }
    #redactor-modal #redactor-modal-close:before {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      font-size: 2rem;
      line-height: 1px;
      position: relative;
      display: block;
      color: #e1e1e1;
      top: 2rem; }
  #redactor-modal-overlay {
    background-color: rgba(28, 28, 28, 0.5); }

.rubrics {
  margin: 0;
  padding: 0;
  list-style: none; }
  .rubrics::after {
    clear: both;
    content: "";
    display: table; }
  .rubrics > li, .rubrics > dd {
    margin: 0; }
  .rubrics__key {
    font-size: 1.5rem;
    line-height: 1.625;
    text-align: right; }
    .rubrics__key ul {
      margin: 0;
      padding: 0;
      list-style: none; }
      .rubrics__key ul::after {
        clear: both;
        content: "";
        display: table; }
      .rubrics__key ul > li, .rubrics__key ul > dd {
        margin: 0; }
      .rubrics__key ul li {
        display: inline-block;
        width: 1.5rem;
        text-align: center; }
      .rubrics__key ul li + li {
        margin-left: .5rem; }
        @media (max-width: 767px) {
          .rubrics__key ul li + li {
            margin-left: .6rem; } }
    .rubrics__key--zero li:first-child {
      margin-right: 1rem; }
  .rubrics__list {
    display: flex;
    justify-content: space-between; }
  .rubrics p, .rubrics .rating {
    margin: 0.5rem 0 0; }
  .rubrics .rating {
    flex: 0 0 auto;
    margin-left: 2rem; }

.screen-reader-section {
  position: absolute;
  left: -9999px;
  height: 1px;
  overflow: hidden; }
  .screen-reader-section ul, .screen-reader-section ol {
    list-style: none; }
  .screen-reader-section.focus-visible:focus, .screen-reader-section.focus-visible:active {
    left: 0;
    height: auto;
    overflow: visible;
    z-index: 999; }

#skip-nav {
  display: block;
  margin: 0.5rem;
  padding: 1rem 2rem;
  background: #ffffff; }

.search-bar-new {
  padding-top: 3.5rem;
  padding-bottom: 3.5rem;
  background: #f5f5f5;
  margin-top: -1.5rem; }
  .search-bar-new .search__form {
    display: table;
    width: 100%;
    position: relative; }
    .search-bar-new .search__form:after {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      -webkit-transform: translateY(-50%);
      -moz-transform: translateY(-50%);
      -ms-transform: translateY(-50%);
      -o-transform: translateY(-50%);
      transform: translateY(-50%);
      position: absolute;
      top: 50%;
      left: 1.25rem; }
    .search-bar-new .search__form__input, .search-bar-new .search__form__more {
      display: table-cell;
      vertical-align: middle; }
    .search-bar-new .search__form__input {
      border-bottom-left-radius: 3px;
      border-top-left-radius: 3px;
      border-bottom-right-radius: 0;
      border-top-right-radius: 0;
      width: 100%;
      padding-left: 4rem;
      border: none;
      text-overflow: ellipsis; }
    .search-bar-new .search__form__more {
      border-bottom-right-radius: 3px;
      border-top-right-radius: 3px;
      font-size: 1.6rem;
      line-height: 1;
      width: 1%;
      background: #00abe6;
      color: #ffffff;
      padding: 0 6rem 0 2.4rem;
      font-weight: 600;
      text-transform: uppercase;
      position: relative; }
      @media (max-width: 767px) {
        .search-bar-new .search__form__more {
          font-size: 0;
          padding-left: 0; } }
      .search-bar-new .search__form__more:before, .search-bar-new .search__form__more:after {
        -webkit-transform: translateY(-50%);
        -moz-transform: translateY(-50%);
        -ms-transform: translateY(-50%);
        -o-transform: translateY(-50%);
        transform: translateY(-50%);
        position: absolute;
        top: 50%;
        display: block;
        width: 2rem;
        height: .2rem;
        content: '';
        background-color: #e4f5fc;
        right: 2rem; }
      .search-bar-new .search__form__more:after {
        -webkit-transition: opacity 0.3s;
        -moz-transition: opacity 0.3s;
        transition: opacity 0.3s;
        -webkit-transform: rotate(90deg);
        -moz-transform: rotate(90deg);
        -ms-transform: rotate(90deg);
        -o-transform: rotate(90deg);
        transform: rotate(90deg);
        margin-top: -.1rem; }
      .search-bar-new .search__form__more.active:after {
        opacity: 0; }
    .search-bar-new .search__form__clear {
      -webkit-transform: translateY(-50%);
      -moz-transform: translateY(-50%);
      -ms-transform: translateY(-50%);
      -o-transform: translateY(-50%);
      transform: translateY(-50%);
      position: absolute;
      top: 50%;
      font-size: 0;
      line-height: 0;
      -webkit-transition: opacity 0.3s;
      -moz-transition: opacity 0.3s;
      transition: opacity 0.3s;
      right: 14.5rem;
      z-index: 2;
      cursor: pointer; }
      .search-bar-new .search__form__clear.ng-hide {
        opacity: 0; }
      .search-bar-new .search__form__clear:before {
        font-size: 1.9rem;
        line-height: 1.625;
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: "×";
        font-weight: 700;
        color: #1c1c1c; }
  .search-bar-new .search__advanced {
    -webkit-transition: max-height 0.3s ease-in-out;
    -moz-transition: max-height 0.3s ease-in-out;
    transition: max-height 0.3s ease-in-out;
    overflow: hidden;
    position: relative;
    padding-top: 3rem; }
    .search-bar-new .search__advanced.ng-enter, .search-bar-new .search__advanced.ng-leave.ng-leave-active {
      max-height: 0; }
    .search-bar-new .search__advanced.ng-leave, .search-bar-new .search__advanced.ng-enter.ng-enter-active {
      max-height: 40rem; }
    .search-bar-new .search__advanced .advanced__category {
      font-weight: 600;
      font-size: 1.4rem;
      line-height: 1.8rem;
      margin-bottom: .75rem;
      text-transform: uppercase;
      color: #00abe6; }
    .search-bar-new .search__advanced .advanced__splitlist::after {
      clear: both;
      content: "";
      display: table; }
    @media (min-width: 850px) {
      .search-bar-new .search__advanced .advanced__splitlist .form__checkbox {
        width: 50%;
        float: left; }
        .search-bar-new .search__advanced .advanced__splitlist .form__checkbox:nth-child(2) {
          margin-top: 0; }
        .search-bar-new .search__advanced .advanced__splitlist .form__checkbox:nth-child(odd) {
          padding-right: 2rem; } }
    .search-bar-new .search__advanced .advanced__check-buttons {
      margin-top: -.5rem;
      margin-left: -.75rem; }
      .search-bar-new .search__advanced .advanced__check-buttons label {
        font-size: 1.4rem;
        line-height: 2.4rem;
        -webkit-transition: background 0.3s;
        -moz-transition: background 0.3s;
        transition: background 0.3s;
        display: inline-block;
        text-transform: uppercase;
        padding: .75rem 1.5rem;
        border: 1px solid #e1e1e1;
        border-radius: 3px;
        margin-top: .5rem;
        margin-left: .75rem; }
        .search-bar-new .search__advanced .advanced__check-buttons label.active {
          background: #ffffff; }
      .search-bar-new .search__advanced .advanced__check-buttons .icon {
        height: 2.4rem;
        width: 2.4rem; }
    .search-bar-new .search__advanced .advanced__slider rzslider {
      display: inline-block;
      width: calc(100% - 10rem); }
    .search-bar-new .search__advanced .advanced__slider .slider__range {
      font-size: 1.5rem;
      line-height: 1.625;
      width: 9rem;
      display: inline-block;
      vertical-align: middle;
      font-weight: 600; }
    .search-bar-new .search__advanced .row {
      margin-bottom: -2rem; }
      @media (min-width: 768px) {
        .search-bar-new .search__advanced .row {
          margin-bottom: -3rem; } }
      .search-bar-new .search__advanced .row > * {
        margin-top: 0;
        margin-bottom: 2rem; }
        @media (min-width: 768px) {
          .search-bar-new .search__advanced .row > * {
            margin-bottom: 3rem; } }
    .search-bar-new .search__advanced rzslider {
      margin: 0; }
      .search-bar-new .search__advanced rzslider .rz-bubble {
        display: none; }
      .search-bar-new .search__advanced rzslider .rz-bar-wrapper {
        height: 1rem;
        padding-top: 0;
        margin-top: -.25rem; }
      .search-bar-new .search__advanced rzslider .rz-bar {
        height: 100%;
        width: 100%;
        border-radius: 1rem;
        box-shadow: inset 0px 2px 2px 0 rgba(147, 149, 152, 0.75); }
      .search-bar-new .search__advanced rzslider .rz-selection {
        background: #00abe6;
        border-bottom: 1px solid #1992c6;
        box-shadow: none; }
      .search-bar-new .search__advanced rzslider .rz-pointer {
        height: 2.4rem;
        width: 2.4rem;
        background: #00abe6;
        border: none;
        top: -1rem; }
        .search-bar-new .search__advanced rzslider .rz-pointer:after {
          top: 50%;
          left: 50%;
          margin-top: -4px;
          margin-left: -4px; }
  .search-bar-new .search__viewing {
    font-size: 1.5rem;
    line-height: 1.625;
    margin-top: .5rem; }

.search-bar {
  padding-top: 2rem;
  padding-bottom: 2rem;
  background: #f5f5f5;
  border-bottom: 1px solid #e1e1e1;
  min-height: 8rem;
  margin-top: -2.5rem; }
  .overlay .search-bar, .search-bar.previewMode, .embed-mode .search-bar {
    margin-top: 0; }
  .search-bar input[type='search'] {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    font-size: 1.9rem;
    line-height: 1.625;
    padding-left: 2.75rem;
    background: none !important;
    line-height: 3.5rem; }
  .search-bar .search__upper {
    display: table;
    width: 100%; }
    .search-bar .search__upper > * {
      display: block;
      vertical-align: middle; }
      @media (min-width: 768px) {
        .search-bar .search__upper > * {
          display: table-cell; } }
    .search-bar .search__upper .input__text {
      font-size: 1.9rem;
      line-height: 1.625; }
      .search-bar .search__upper .input__text label {
        display: none; }
      .search-bar .search__upper .input__text input {
        -webkit-transition: all 0.15s ease-in-out;
        -moz-transition: all 0.15s ease-in-out;
        transition: all 0.15s ease-in-out;
        height: 3.5rem;
        border-bottom: solid 1px #e1e1e1; }
        .search-bar .search__upper .input__text input:focus {
          border-color: #faa21b; }
      .search-bar .search__upper .input__text .selectize-control {
        margin-top: 0; }
      .search-bar .search__upper .input__text .selectize-input {
        -webkit-transition: all 0.15s ease-in-out;
        -moz-transition: all 0.15s ease-in-out;
        transition: all 0.15s ease-in-out;
        font-size: 1.9rem;
        line-height: 1.625;
        padding: 0 0 0 2.75rem;
        width: 100%;
        background: transparent;
        border-bottom: solid 1px #e1e1e1; }
        .search-bar .search__upper .input__text .selectize-input::after {
          display: none; }
        .search-bar .search__upper .input__text .selectize-input .item {
          -webkit-transition: all 0.15s ease-in-out;
          -moz-transition: all 0.15s ease-in-out;
          transition: all 0.15s ease-in-out;
          font-size: 1.6rem;
          line-height: 1;
          padding: 0.5rem 1.5rem !important;
          background: #ffffff;
          border: solid 1px #e1e1e1;
          border-radius: .5rem;
          color: #faa21b;
          box-shadow: none; }
          .search-bar .search__upper .input__text .selectize-input .item::after {
            -webkit-transition: all 0.15s ease-in-out;
            -moz-transition: all 0.15s ease-in-out;
            transition: all 0.15s ease-in-out;
            font-family: "ss-icons";
            width: auto;
            margin: 0;
            font-style: normal;
            font-weight: normal;
            speak: none;
            display: inline-block;
            text-decoration: inherit;
            line-height: 1em;
            text-align: center;
            font-variant: normal;
            text-transform: none;
            vertical-align: middle;
            position: relative;
            top: -1px;
            text-rendering: optimizeLegibility;
            content: "";
            color: #e1e1e1;
            margin-left: 1rem; }
          .search-bar .search__upper .input__text .selectize-input .item:hover {
            border-color: #faa21b; }
            .search-bar .search__upper .input__text .selectize-input .item:hover::after {
              color: #faa21b; }
          .search-bar .search__upper .input__text .selectize-input .item:first-child {
            margin-left: 2.75rem; }
          .search-bar .search__upper .input__text .selectize-input .item.active {
            -webkit-transition: all 0.15s ease-in-out;
            -moz-transition: all 0.15s ease-in-out;
            transition: all 0.15s ease-in-out;
            background: #ffffff;
            border: solid 1px #e1e1e1; }
            .search-bar .search__upper .input__text .selectize-input .item.active:hover {
              border-color: #faa21b; }
            .search-bar .search__upper .input__text .selectize-input .item.active .remove {
              border-left-color: transparent; }
          .search-bar .search__upper .input__text .selectize-input .item .remove {
            position: absolute;
            top: 0;
            right: 0;
            color: #939598;
            width: 100%;
            text-indent: -9999rem; }
            .search-bar .search__upper .input__text .selectize-input .item .remove:hover {
              background-color: transparent; }
        .search-bar .search__upper .input__text .selectize-input input {
          height: auto; }
    .search-bar .search__upper .input__helper {
      display: none; }
    .search-bar .search__upper .upper__toggler {
      text-align: center; }
      @media (min-width: 768px) {
        .search-bar .search__upper .upper__toggler {
          width: 1%;
          white-space: nowrap;
          padding-left: 24px;
          text-align: inherit; } }
      .search-bar .search__upper .upper__toggler button {
        margin-top: 1rem; }
        @media (min-width: 768px) {
          .search-bar .search__upper .upper__toggler button {
            margin-top: inherit; } }
  .search-bar .search__middle {
    margin-top: .5rem; }
    .search-bar .search__middle .middle__tags::before {
      margin: 1rem 0.5rem;
      color: #939598; }
    .search-bar .search__middle .middle__tags .tags__explore {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      font-size: 1.5rem;
      line-height: 1.625;
      padding: 0.4rem 0;
      display: inline-block;
      margin-bottom: .8rem;
      color: #939598;
      white-space: nowrap; }
      .search-bar .search__middle .middle__tags .tags__explore::before {
        -webkit-transition: none;
        -moz-transition: none;
        transition: none;
        display: inherit;
        margin-right: .5rem;
        opacity: .5; }
      .search-bar .search__middle .middle__tags .tags__explore:hover {
        color: #faa21b; }
    .search-bar .search__middle .middle__tags .picker__list {
      margin-top: 0; }
  .search-bar .search__lower strong, .search-bar .search__lower .category {
    font-size: 1.7rem;
    line-height: 1.625;
    color: #00abe6;
    font-weight: 500; }
  .search-bar .search__lower [col-sm='12'] + [col-sm='12'] {
    margin: 0; }
  .search-bar .search__lower .lower__checkbox strong, .search-bar .search__lower .lower__checkbox .category {
    margin: 1.5rem 0 1rem;
    display: block; }
  .search-bar .search__lower .lower__checkbox p {
    font-size: 1.5rem;
    line-height: 1.625; }
  .search-bar .search__lower .lower__checkbox .checkbox__split {
    -webkit-columns: 1;
    -moz-columns: 1;
    columns: 1;
    margin: 0;
    padding: 0;
    list-style: none; }
    .search-bar .search__lower .lower__checkbox .checkbox__split::after {
      clear: both;
      content: "";
      display: table; }
    .search-bar .search__lower .lower__checkbox .checkbox__split > li, .search-bar .search__lower .lower__checkbox .checkbox__split > dd {
      margin: 0; }
    @media (min-width: 768px) {
      .search-bar .search__lower .lower__checkbox .checkbox__split {
        -webkit-columns: 2;
        -moz-columns: 2;
        columns: 2; } }
    .search-bar .search__lower .lower__checkbox .checkbox__split .checkbox-list li {
      width: 100%;
      margin-top: 0;
      margin-bottom: .8rem; }
    .search-bar .search__lower .lower__checkbox .checkbox__split > li {
      display: inline-block;
      width: 100%;
      -webkit-column-break-inside: avoid;
      page-break-inside: avoid;
      break-inside: avoid; }
  .search-bar .search__lower .lower__checkbox .checkbox__child {
    margin-bottom: .8rem; }
  .search-bar .search__lower .lower__checkbox .standards__description strong {
    color: #4b4a4b; }
  .search-bar .search__lower .lower__slider {
    margin-top: 3rem; }
  .search-bar .search__check-buttons label {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    margin: 0 0.8rem 0.8rem 0;
    font-size: 1.4rem;
    line-height: 2.4rem;
    display: inline-block;
    text-transform: uppercase;
    padding: .75rem 1.5rem;
    border: 1px solid #e1e1e1;
    border-radius: 3px; }
    .search-bar .search__check-buttons label.active {
      background: #ffffff; }
  .search-bar .search__check-buttons .icon {
    height: 2.4rem;
    width: 2.4rem; }
  .search-bar rzslider {
    margin: 3rem 0; }
    .search-bar rzslider .rz-bar {
      height: .7rem; }
      .search-bar rzslider .rz-bar.rz-selection {
        width: inherit;
        background: #00abe6; }
    .search-bar rzslider .rz-pointer {
      -webkit-transition: background 0.15s ease-in-out;
      -moz-transition: background 0.15s ease-in-out;
      transition: background 0.15s ease-in-out;
      height: 1.5rem;
      width: .7rem;
      top: -.4rem;
      background: #00abe6;
      border: none;
      box-shadow: 0.3rem 0 2.5rem -0.5rem rgba(28, 28, 28, 0.2); }
      .search-bar rzslider .rz-pointer::after {
        display: none; }
    .search-bar rzslider .rz-bubble.rz-limit {
      font-size: 1.3rem;
      line-height: 1.625;
      top: 1.6rem;
      color: #939598; }

.section-padding--none {
  padding-top: 0;
  padding-bottom: 0; }

.section-padding--none-none {
  padding-top: 0;
  padding-bottom: 0; }

.section-padding--none-xxsmall {
  padding-top: 0;
  padding-top: 1rem; }

.section-padding--none-xsmall {
  padding-top: 0;
  padding-bottom: 2rem; }

.section-padding--none-small {
  padding-top: 0;
  padding-bottom: 3rem; }

.section-padding--none-medium {
  padding-top: 0;
  padding-bottom: 4rem; }

.section-padding--none-large {
  padding-top: 0;
  padding-bottom: 5rem; }

.section-padding--xxsmall {
  padding-top: 1rem;
  padding-top: 1rem; }

.section-padding--xxsmall-none {
  padding-top: 1rem;
  padding-bottom: 0; }

.section-padding--xxsmall-xxsmall {
  padding-top: 1rem;
  padding-top: 1rem; }

.section-padding--xxsmall-xsmall {
  padding-top: 1rem;
  padding-bottom: 2rem; }

.section-padding--xxsmall-small {
  padding-top: 1rem;
  padding-bottom: 3rem; }

.section-padding--xxsmall-medium {
  padding-top: 1rem;
  padding-bottom: 4rem; }

.section-padding--xxsmall-large {
  padding-top: 1rem;
  padding-bottom: 5rem; }

.section-padding--xsmall {
  padding-top: 2rem;
  padding-bottom: 2rem; }

.section-padding--xsmall-none {
  padding-top: 2rem;
  padding-bottom: 0; }

.section-padding--xsmall-xxsmall {
  padding-top: 2rem;
  padding-top: 1rem; }

.section-padding--xsmall-xsmall {
  padding-top: 2rem;
  padding-bottom: 2rem; }

.section-padding--xsmall-small {
  padding-top: 2rem;
  padding-bottom: 3rem; }

.section-padding--xsmall-medium {
  padding-top: 2rem;
  padding-bottom: 4rem; }

.section-padding--xsmall-large {
  padding-top: 2rem;
  padding-bottom: 5rem; }

.section-padding--small {
  padding-top: 3rem;
  padding-bottom: 3rem; }

.section-padding--small-none {
  padding-top: 3rem;
  padding-bottom: 0; }

.section-padding--small-xxsmall {
  padding-top: 3rem;
  padding-top: 1rem; }

.section-padding--small-xsmall {
  padding-top: 3rem;
  padding-bottom: 2rem; }

.section-padding--small-small {
  padding-top: 3rem;
  padding-bottom: 3rem; }

.section-padding--small-medium {
  padding-top: 3rem;
  padding-bottom: 4rem; }

.section-padding--small-large {
  padding-top: 3rem;
  padding-bottom: 5rem; }

.section-padding--medium {
  padding-top: 4rem;
  padding-bottom: 4rem; }

.section-padding--medium-none {
  padding-top: 4rem;
  padding-bottom: 0; }

.section-padding--medium-xxsmall {
  padding-top: 4rem;
  padding-top: 1rem; }

.section-padding--medium-xsmall {
  padding-top: 4rem;
  padding-bottom: 2rem; }

.section-padding--medium-small {
  padding-top: 4rem;
  padding-bottom: 3rem; }

.section-padding--medium-medium {
  padding-top: 4rem;
  padding-bottom: 4rem; }

.section-padding--medium-large {
  padding-top: 4rem;
  padding-bottom: 5rem; }

.section-padding--large {
  padding-top: 5rem;
  padding-bottom: 5rem; }

.section-padding--large-none {
  padding-top: 5rem;
  padding-bottom: 0; }

.section-padding--large-xxsmall {
  padding-top: 5rem;
  padding-top: 1rem; }

.section-padding--large-xsmall {
  padding-top: 5rem;
  padding-bottom: 2rem; }

.section-padding--large-small {
  padding-top: 5rem;
  padding-bottom: 3rem; }

.section-padding--large-medium {
  padding-top: 5rem;
  padding-bottom: 4rem; }

.section-padding--large-large {
  padding-top: 5rem;
  padding-bottom: 5rem; }

.selectize-control.single .selectize-input, .selectize-input, .selectize-input {
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out;
  display: block;
  background: none;
  box-shadow: none;
  border-color: #e1e1e1;
  color: #4b4a4b; }
  .selectize-control.single .selectize-input:before, .selectize-input:before, .selectize-input:before {
    display: none; }
  .selectize-control.single .selectize-input:after, .selectize-input:after, .selectize-input:after {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: "";
    height: auto;
    width: auto;
    -webkit-transform: translateY(-50%);
    -moz-transform: translateY(-50%);
    -ms-transform: translateY(-50%);
    -o-transform: translateY(-50%);
    transform: translateY(-50%);
    position: absolute;
    top: 50%;
    right: 1.5rem;
    margin: 0 !important;
    opacity: .5;
    border: none; }
  .selectize-control.single .selectize-input > *, .selectize-input > *, .selectize-input > * {
    line-height: 1.3; }
  .selectize-control.single .selectize-input input, .selectize-input input, .selectize-input input {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    border-color: #e1e1e1; }
  .selectize-control.single .selectize-input.input-active, .selectize-input.input-active, .selectize-input.input-active {
    display: block; }
  .selectize-control.single .selectize-input.dropdown-active, .selectize-input.dropdown-active, .selectize-input.dropdown-active {
    border-color: #faa21b; }
  .selectize-control.single .selectize-input.disabled, .selectize-input.disabled, .selectize-input.disabled {
    background: none !important;
    opacity: 1 !important;
    border-color: transparent !important; }
    .selectize-control.single .selectize-input.disabled:after, .selectize-input.disabled:after, .selectize-input.disabled:after {
      display: none; }
  .selectize-control.single .selectize-input.focus, .selectize-input.focus, .selectize-input.focus {
    box-shadow: none;
    border-color: #faa21b; }

[autocomplete] .selectize-control .selectize-input:after {
  display: none !important; }

.selectize-dropdown, .selectize-dropdown.single {
  border-color: #e1e1e1;
  margin: 0;
  border-radius: 0 0 5px 5px;
  box-shadow: 0 1px 3px 0 rgba(28, 28, 28, 0.1);
  z-index: 101; }

.selectize-dropdown .selectize-dropdown-desc {
  font-size: 1.3rem;
  line-height: 1.625; }

.selectize-control.multi .selectize-input.has-items {
  padding-right: 0;
  padding-left: 0; }

.selectize-control.multi .selectize-input [data-value], .selectize-control.multi .selectize-input [data-value].active {
  background: #faa21b;
  border-color: #faa21b;
  text-shadow: none; }

.selectize-control.plugin-remove_button [data-value] .remove {
  font-size: 1.6rem;
  border-color: rgba(255, 255, 255, 0.4); }

.sidebar {
  padding-right: 3rem; }
  .sidebar .sidebar__headline h1 {
    font-size: 3rem;
    line-height: 1;
    font-weight: 500; }
  .sidebar .sidebar__headline input {
    font-size: 3rem;
    height: 3rem;
    font-weight: 500; }
  .sidebar .sidebar__subtext {
    font-size: 1.6rem;
    line-height: 1.3;
    margin: 0 0 2rem;
    font-weight: 300;
    color: #1c1c1c; }
    .sidebar .sidebar__subtext strong {
      font-weight: 500; }
  .sidebar .sidebar__image img {
    display: block; }
  .sidebar .sidebar__nav {
    margin: 0;
    padding: 0;
    list-style: none;
    margin: 2rem 0;
    border: solid #e1e1e1;
    border-width: 1px 0;
    counter-reset: li; }
    .sidebar .sidebar__nav::after {
      clear: both;
      content: "";
      display: table; }
    .sidebar .sidebar__nav > li, .sidebar .sidebar__nav > dd {
      margin: 0; }
    .sidebar .sidebar__nav li {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      display: block;
      counter-increment: li; }
      .sidebar .sidebar__nav li + li {
        border-top: 1px solid #e1e1e1; }
    .sidebar .sidebar__nav a {
      font-size: 1.6rem;
      line-height: 1;
      display: block;
      padding: 1.5rem 1rem;
      color: #1c1c1c;
      font-weight: 500; }
    .sidebar .sidebar__nav .active {
      background: rgba(225, 225, 225, 0.3);
      color: #f77e0d; }
      .sidebar .sidebar__nav .active a {
        color: #f77e0d; }
  .sidebar .sidebar__details {
    font-size: 1.6rem; }
    .sidebar .sidebar__details .details__meta {
      margin: 0;
      padding: 0;
      list-style: none;
      margin-top: -1em; }
      .sidebar .sidebar__details .details__meta::after {
        clear: both;
        content: "";
        display: table; }
      .sidebar .sidebar__details .details__meta > li, .sidebar .sidebar__details .details__meta > dd {
        margin: 0; }
      .sidebar .sidebar__details .details__meta dt, .sidebar .sidebar__details .details__meta dd {
        margin-top: 1em; }
      .sidebar .sidebar__details .details__meta dt {
        display: block;
        float: left;
        clear: left; }
      .sidebar .sidebar__details .details__meta dd {
        display: block;
        float: left;
        margin-left: .5rem;
        color: #1c1c1c; }
    .sidebar .sidebar__details .details__actions {
      margin-top: 1.5rem; }
      .sidebar .sidebar__details .details__actions.active {
        background-color: #faa21b;
        border-color: #faa21b;
        color: #ffffff !important; }
    .sidebar .sidebar__details .details__options li {
      margin-top: 2rem; }

@media print {
  .sidebar {
    display: none; } }

.spotlight {
  font-size: 1.5rem;
  line-height: 1.4;
  background: #f5f5f5;
  border-radius: 5px;
  padding: 3rem; }
  .spotlight a {
    color: #00abe6; }
  .spotlight h4 {
    margin-top: 2rem;
    margin-bottom: 1rem;
    font-weight: 500; }
    .spotlight h4:first-child {
      margin-top: 0; }
    .spotlight h4:last-child {
      margin-bottom: 0; }
  .spotlight .spotlight__list {
    margin: 0;
    padding: 0;
    list-style: none; }
    .spotlight .spotlight__list::after {
      clear: both;
      content: "";
      display: table; }
    .spotlight .spotlight__list > li, .spotlight .spotlight__list > dd {
      margin: 0; }

.ss-annotation {
  font-size: 1.3rem;
  line-height: 1.625;
  position: absolute;
  top: -999.9rem;
  right: auto;
  bottom: auto;
  left: -999.9rem;
  -webkit-transform: translateY(-100%);
  -moz-transform: translateY(-100%);
  -ms-transform: translateY(-100%);
  -o-transform: translateY(-100%);
  transform: translateY(-100%);
  -webkit-animation-name: fadeIn;
  -moz-animation-name: fadeIn;
  animation-name: fadeIn;
  -webkit-animation-fill-mode: both;
  -moz-animation-fill-mode: both;
  animation-fill-mode: both;
  width: 32rem;
  padding: 0 1rem;
  z-index: 101;
  opacity: 1;
  background: #ffffff;
  border: 1px solid #e1e1e1;
  border-radius: .4rem;
  box-shadow: 0.3rem 0.5rem 2.5rem -0.5rem rgba(28, 28, 28, 0.2), -0.3rem 0.5rem 2.5rem -0.5rem rgba(28, 28, 28, 0.2); }
  .ss-annotation.active {
    margin-top: -.9rem; }
  .ss-annotation::after, .ss-annotation::before {
    -webkit-transform: translateX(-50%);
    -moz-transform: translateX(-50%);
    -ms-transform: translateX(-50%);
    -o-transform: translateX(-50%);
    transform: translateX(-50%);
    content: '';
    position: absolute;
    left: 50%; }
  .ss-annotation::before {
    height: 0;
    width: 0;
    border-left: 11px solid transparent;
    border-right: 11px solid transparent;
    border-top: 11px solid #e1e1e1;
    bottom: -11px; }
  .ss-annotation::after {
    height: 0;
    width: 0;
    border-left: 10px solid transparent;
    border-right: 10px solid transparent;
    border-top: 10px solid #ffffff;
    bottom: -10px; }
  .ss-annotation__flip::before {
    border-top: none;
    height: 0;
    width: 0;
    border-bottom: 10px solid #e1e1e1;
    border-left: 10px solid transparent;
    border-right: 10px solid transparent;
    bottom: auto;
    top: -11px; }
  .ss-annotation__flip::after {
    border-top: none;
    height: 0;
    width: 0;
    border-bottom: 10px solid #ffffff;
    border-left: 10px solid transparent;
    border-right: 10px solid transparent;
    bottom: auto;
    top: -10px; }
  .ss-annotation .annotation__actions .actions__title {
    display: inline-block;
    padding: 1rem 1rem 1rem 0;
    float: left;
    font-size: 1.4rem; }
  .ss-annotation .annotation__actions .actions__all {
    float: left; }
    .ss-annotation .annotation__actions .actions__all li:first-child {
      padding-left: 0; }
    .ss-annotation .annotation__actions .actions__all .droppable-overlay {
      width: 22rem;
      padding: 1rem 0; }
      .ss-annotation .annotation__actions .actions__all .droppable-overlay:before {
        left: 1.5rem; }
      .ss-annotation .annotation__actions .actions__all .droppable-overlay li {
        padding: .5rem 2rem;
        width: 50%;
        font-size: 1.4rem; }
        .ss-annotation .annotation__actions .actions__all .droppable-overlay li:hover {
          -webkit-transition: ease-in-out, 0.15s;
          -moz-transition: ease-in-out, 0.15s;
          transition: ease-in-out, 0.15s;
          -webkit-transform: scale(1.1);
          -moz-transform: scale(1.1);
          -ms-transform: scale(1.1);
          -o-transform: scale(1.1);
          transform: scale(1.1);
          background: inherit; }
      .ss-annotation .annotation__actions .actions__all .droppable-overlay li > * {
        padding: 0; }
  .ss-annotation .annotation__actions .actions__swatch::after {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: "";
    top: 0;
    color: #939598; }
  .ss-annotation .annotation__actions .actions__template {
    margin-right: 2rem;
    float: right; }
    .ss-annotation .annotation__actions .actions__template .droppable-overlay {
      width: 33rem;
      padding: 0 1rem; }
      .ss-annotation .annotation__actions .actions__template .droppable-overlay .inline-state-nav li {
        width: 50%;
        padding: 0;
        text-align: center;
        font-size: 1.4rem; }
        .ss-annotation .annotation__actions .actions__template .droppable-overlay .inline-state-nav li:hover {
          background: inherit; }
        .ss-annotation .annotation__actions .actions__template .droppable-overlay .inline-state-nav li a {
          padding-right: 0;
          padding-left: 0; }
      .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries {
        height: 17rem;
        overflow: scroll; }
        .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries li {
          width: 100%;
          padding: 0; }
          .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries li:hover {
            -webkit-transition: ease-in-out, 0.15s;
            -moz-transition: ease-in-out, 0.15s;
            transition: ease-in-out, 0.15s;
            background: inherit; }
          .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries li a {
            width: 100%;
            padding: 1rem 0;
            margin: 0;
            float: left;
            color: #4b4a4b;
            overflow: hidden;
            text-overflow: ellipsis; }
            .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries li a:hover {
              color: #faa21b; }
          .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries li i {
            padding: 1rem;
            float: left;
            color: #e1e1e1;
            cursor: pointer; }
            .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries li i:hover {
              color: #faa21b; }
        .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries li > * {
          padding: 0; }
        .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__entries--saved li a {
          width: 89%; }
      .ss-annotation .annotation__actions .actions__template .droppable-overlay .responses__blank {
        font-size: 1.5rem;
        line-height: 1.625;
        height: 17rem;
        padding-top: 6.5rem;
        text-align: center; }
      .ss-annotation .annotation__actions .actions__template .droppable-overlay button {
        width: 100%;
        padding: 1rem 0;
        border-top: 1px solid #e1e1e1; }
  .ss-annotation .annotation__actions .actions__responses::after {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: "";
    top: 0;
    color: #939598;
    padding-left: .5rem; }
  .ss-annotation .annotation__actions .actions__edit {
    margin-right: 2rem;
    float: right; }
    .ss-annotation .annotation__actions .actions__edit li:last-child button {
      color: #939598; }
      .ss-annotation .annotation__actions .actions__edit li:last-child button:hover {
        color: #e1e1e1; }
  .ss-annotation .annotation__actions ul {
    margin: 0;
    padding: 0;
    list-style: none; }
    .ss-annotation .annotation__actions ul::after {
      clear: both;
      content: "";
      display: table; }
    .ss-annotation .annotation__actions ul > li, .ss-annotation .annotation__actions ul > dd {
      margin: 0; }
    .ss-annotation .annotation__actions ul li {
      display: inline-block;
      float: left;
      padding: 1rem; }
  .ss-annotation .annotation__note--content {
    -webkit-user-select: all;
    -moz-user-select: all;
    -ms-user-select: all;
    user-select: all;
    padding: 1rem 0;
    border-top: 1px solid #e1e1e1;
    clear: both;
    word-wrap: break-word; }
  .ss-annotation .annotation__note textarea {
    font-size: small;
    height: 7.5rem;
    padding: .5rem 0;
    border-radius: 0;
    border-top: 1px solid #e1e1e1;
    border-right: none;
    border-bottom: 1px solid #e1e1e1;
    border-left: none;
    resize: none;
    -webkit-appearance: none; }
    .ss-annotation .annotation__note textarea::placeholder {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out; }
  .ss-annotation .annotation__note button {
    width: 100%; }
  .ss-annotation .annotation__confirm {
    padding: 1rem 0; }
  .ss-annotation button {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    color: #faa21b;
    font-size: 1.4rem; }
    .ss-annotation button::before {
      top: 0;
      margin-right: .5rem;
      width: 1em; }
    .ss-annotation button:hover {
      color: #f77e0d; }
    .ss-annotation button.icon-trash {
      color: #939598; }
      .ss-annotation button.icon-trash:hover {
        color: #4b4a4b; }
    .ss-annotation button.icon-cancel {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      position: absolute;
      top: 0.75rem;
      right: 0.5rem;
      padding-left: 1rem;
      color: #939598; }
      .ss-annotation button.icon-cancel:hover {
        color: #4b4a4b; }

.annotation__swatch {
  display: inline-block;
  width: 1.5rem;
  height: 1.5rem;
  margin-right: .5rem !important;
  border-radius: .4rem;
  background: #faa21b;
  vertical-align: middle;
  content: ''; }
  .annotation__swatch.color-1 {
    background-color: #ffdc19 !important; }
  .annotation__swatch.color-2 {
    background-color: #9a488e !important; }
  .annotation__swatch.color-3 {
    background-color: #faa21b !important; }
  .annotation__swatch.color-4 {
    background-color: #00abe6 !important; }
  .annotation__swatch.color-5 {
    background-color: #da5450 !important; }
  .annotation__swatch.color-6 {
    background-color: #92af2b !important; }

@media print {
  .ss-audio {
    display: none; } }

.ss-audio-dialog.ngdialog {
  position: fixed;
  top: auto;
  right: 0;
  bottom: 0;
  left: 0;
  padding: 0;
  overflow: visible; }
  .ss-audio-dialog.ngdialog .ngdialog-content {
    -webkit-animation-name: slideInUp;
    -moz-animation-name: slideInUp;
    animation-name: slideInUp;
    -webkit-animation-delay: 0;
    -moz-animation-delay: 0;
    animation-delay: 0;
    -webkit-animation-duration: 0.3;
    -moz-animation-duration: 0.3;
    animation-duration: 0.3;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both;
    width: 100%;
    max-width: none;
    background: none;
    overflow: visible; }
  .ss-audio-dialog.ngdialog.ngdialog-closing .ngdialog-content {
    -webkit-animation-name: slideOutDown;
    -moz-animation-name: slideOutDown;
    animation-name: slideOutDown;
    -webkit-animation-delay: 0;
    -moz-animation-delay: 0;
    animation-delay: 0;
    -webkit-animation-duration: 0.3;
    -moz-animation-duration: 0.3;
    animation-duration: 0.3;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both; }

.ss-audio-player {
  -webkit-user-select: none;
  -moz-user-select: none;
  -ms-user-select: none;
  user-select: none;
  font-size: 1.5rem;
  line-height: 1.625;
  display: block;
  max-width: 1100px;
  margin: 0 auto;
  color: #939598;
  position: relative; }
  @media print {
    .ss-audio-player {
      display: none; } }
  .ss-audio-player .audio__scrubber {
    -webkit-box-flex: 1;
    -moz-box-flex: 1;
    box-flex: 1;
    -webkit-flex: 1;
    -moz-flex: 1;
    -ms-flex: 1;
    flex: 1;
    line-height: 0; }
    .ss-audio-player .audio__scrubber rzslider .rz-bar {
      -webkit-transition: height 0.15s ease-in-out;
      -moz-transition: height 0.15s ease-in-out;
      transition: height 0.15s ease-in-out; }
      @media (min-width: 768px) {
        .ss-audio-player .audio__scrubber rzslider .rz-bar {
          bottom: 0; } }
    .ss-audio-player .audio__scrubber rzslider .rz-pointer {
      height: 1rem;
      width: 1rem;
      -webkit-transition: -webkit-transform 0.15s ease-in-out, opacity 0.15s ease-in-out;
      -moz-transition: -moz-transform 0.15s ease-in-out, opacity 0.15s ease-in-out;
      transition: transform 0.15s ease-in-out, opacity 0.15s ease-in-out;
      opacity: 0; }
      .ss-audio-player .audio__scrubber rzslider .rz-pointer:focus {
        opacity: 1; }
  .ss-audio-player .audio__controls {
    display: -webkit-box;
    display: -moz-box;
    display: box;
    display: -webkit-flex;
    display: -moz-flex;
    display: -ms-flexbox;
    display: flex;
    -webkit-box-align: center;
    -moz-box-align: center;
    box-align: center;
    -webkit-align-items: center;
    -moz-align-items: center;
    -ms-align-items: center;
    -o-align-items: center;
    align-items: center;
    -ms-flex-align: center;
    -webkit-box-pack: justify;
    -moz-box-pack: justify;
    box-pack: justify;
    -webkit-justify-content: space-between;
    -moz-justify-content: space-between;
    -ms-justify-content: space-between;
    -o-justify-content: space-between;
    justify-content: space-between;
    -ms-flex-pack: justify;
    padding: 1rem;
    background: #ffffff;
    white-space: nowrap;
    border: solid 1px #e1e1e1;
    border-radius: 4px;
    line-height: 1; }
    .ss-audio-player .audio__controls ul {
      margin: 0;
      padding: 0;
      list-style: none;
      display: -webkit-box;
      display: -moz-box;
      display: box;
      display: -webkit-flex;
      display: -moz-flex;
      display: -ms-flexbox;
      display: flex; }
      .ss-audio-player .audio__controls ul::after {
        clear: both;
        content: "";
        display: table; }
      .ss-audio-player .audio__controls ul > li, .ss-audio-player .audio__controls ul > dd {
        margin: 0; }
    .ss-audio-player .audio__controls .controls__left li {
      margin-right: 1rem; }
    .ss-audio-player .audio__controls .controls__right li {
      margin-left: 1rem; }
    .ss-audio-player .audio__controls .controls__audio {
      display: -webkit-box;
      display: -moz-box;
      display: box;
      display: -webkit-flex;
      display: -moz-flex;
      display: -ms-flexbox;
      display: flex;
      -webkit-box-align: center;
      -moz-box-align: center;
      box-align: center;
      -webkit-align-items: center;
      -moz-align-items: center;
      -ms-align-items: center;
      -o-align-items: center;
      align-items: center;
      -ms-flex-align: center; }
      @media (max-width: 767px) {
        .ss-audio-player .audio__controls .controls__audio {
          display: none; } }
      .ss-audio-player .audio__controls .controls__audio rzslider {
        width: 8rem;
        margin-left: .5rem; }
        .ss-audio-player .audio__controls .controls__audio rzslider .rz-pointer {
          height: 1.5rem;
          width: 0.6rem; }
        .ss-audio-player .audio__controls .controls__audio rzslider:hover .rz-selection {
          -webkit-transition: background 0.15s ease-in-out;
          -moz-transition: background 0.15s ease-in-out;
          transition: background 0.15s ease-in-out;
          background: #faa21b; }
        .ss-audio-player .audio__controls .controls__audio rzslider:hover .rz-pointer {
          -webkit-transition: background 0.15s ease-in-out;
          -moz-transition: background 0.15s ease-in-out;
          transition: background 0.15s ease-in-out;
          background: #faa21b; }
      .ss-audio-player .audio__controls .controls__audio.muted .rz-selection, .ss-audio-player .audio__controls .controls__audio.muted .rz-pointer {
        background: #e1e1e1; }
    .ss-audio-player .audio__controls .controls__time span {
      display: inline-block; }
      .ss-audio-player .audio__controls .controls__time span:first-child {
        min-width: 4rem;
        text-align: center; }
    .ss-audio-player .audio__controls .controls__time .time__separator {
      min-width: 1.5rem;
      text-align: center; }
  .ss-audio-player .audio__btn {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out; }
    .ss-audio-player .audio__btn.icon-volume {
      color: #faa21b; }
    .ss-audio-player .audio__btn::before {
      margin-right: .5rem;
      width: 1em; }
    .ss-audio-player .audio__btn:empty:before {
      margin-right: 0; }
    .ss-audio-player .audio__btn.active {
      color: #faa21b; }
    @media (min-width: 768px) {
      .ss-audio-player .audio__btn:hover {
        color: #faa21b; } }
  .ss-audio-player:hover .audio__scrubber rzslider .rz-pointer {
    opacity: 1; }
  .ss-audio-player rzslider {
    margin: 0; }
    .ss-audio-player rzslider .rz-bubble {
      display: none; }
    .ss-audio-player rzslider .rz-pointer {
      -webkit-transform: translateY(calc(-50% + 2px));
      -moz-transform: translateY(calc(-50% + 2px));
      -ms-transform: translateY(calc(-50% + 2px));
      -o-transform: translateY(calc(-50% + 2px));
      transform: translateY(calc(-50% + 2px));
      background: #faa21b;
      border: none;
      top: 0; }
      .ss-audio-player rzslider .rz-pointer:after {
        display: none; }
    .ss-audio-player rzslider .rz-bar-wrapper {
      margin-top: 0;
      padding-top: 0;
      height: 100%;
      opacity: 1 !important;
      cursor: pointer; }
    .ss-audio-player rzslider .rz-bar {
      height: 100%;
      background: #e1e1e1;
      border-radius: 0; }
      .ss-audio-player rzslider .rz-bar.rz-selection {
        width: 100%;
        background: #faa21b;
        border-radius: 0; }

.ss-audio--large .audio__scrubber {
  position: absolute;
  top: 0;
  right: 0;
  left: 0; }
  .ss-audio--large .audio__scrubber:hover .rz-bar {
    height: 8px; }
  .ss-audio--large .audio__scrubber:hover .rz-pointer {
    -webkit-transform: translateY(-50%) scale(1.5);
    -moz-transform: translateY(-50%) scale(1.5);
    -ms-transform: translateY(-50%) scale(1.5);
    -o-transform: translateY(-50%) scale(1.5);
    transform: translateY(-50%) scale(1.5); }

.ss-audio--large .audio__controls {
  padding: calc(1.5rem + 4px) 1.5rem 1.5rem;
  box-shadow: 0.3rem 0 2.5rem -0.5rem rgba(28, 28, 28, 0.2), -0.3rem 0 2.5rem -0.5rem rgba(28, 28, 28, 0.2);
  border-radius: 0;
  border: none; }

[ss-bind-html] .word {
  display: inline-block; }

[ss-bind-html] blockquote .blocknumber {
  color: #faa21b;
  margin-right: .5rem; }

[ss-bind-html] .works-cited {
  border-top: solid 1px #e1e1e1;
  margin-top: 3rem;
  padding-top: 3rem; }
  [ss-bind-html] .works-cited p {
    text-indent: -3rem;
    padding-left: 3rem;
    line-height: 2; }

.ss-form .form__section {
  display: block;
  clear: both;
  display: block;
  position: relative;
  margin-left: -12px;
  margin-right: -12px;
  border-top: 1px solid #e1e1e1; }
  .ss-form .form__section::after {
    clear: both;
    content: "";
    display: table; }
  .ss-form .form__section > * {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    .ss-form .form__section > *:last-child {
      margin-right: 0; }
    @media print {
      .ss-form .form__section > * {
        float: left !important; } }
  .ss-form .form__section .section__title {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0;
    margin-bottom: 1.5rem; }
    .ss-form .form__section .section__title:last-child {
      margin-right: 0; }
    @media print {
      .ss-form .form__section .section__title {
        float: left !important; } }
    @media (min-width: 768px) {
      .ss-form .form__section .section__title {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 22.11538%;
        width: 25%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0; }
        .ss-form .form__section .section__title:last-child {
          margin-right: 0; } }
  @media print and (min-width: 768px) {
    .ss-form .form__section .section__title {
      float: left !important; } }
    .ss-form .form__section .section__title h1, .ss-form .form__section .section__title h2, .ss-form .form__section .section__title h3, .ss-form .form__section .section__title h4, .ss-form .form__section .section__title h5, .ss-form .form__section .section__title h6 {
      font-size: 2.1rem;
      line-height: 1.3; }
  .ss-form .form__section .section__body {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    .ss-form .form__section .section__body:last-child {
      margin-right: 0; }
    @media print {
      .ss-form .form__section .section__body {
        float: left !important; } }
    @media (min-width: 768px) {
      .ss-form .form__section .section__body {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 74.03846%;
        width: 75%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0; }
        .ss-form .form__section .section__body:last-child {
          margin-right: 0; } }
  @media print and (min-width: 768px) {
    .ss-form .form__section .section__body {
      float: left !important; } }
    .ss-form .form__section .section__body h3 {
      line-height: inherit; }
  .ss-form .form__section--top {
    border-top: 0; }

.ss-form .form__prompts {
  margin: 0;
  padding: 0;
  list-style: none;
  margin-right: -1.5rem;
  margin-bottom: 3rem;
  white-space: nowrap; }
  .ss-form .form__prompts::after {
    clear: both;
    content: "";
    display: table; }
  .ss-form .form__prompts > li, .ss-form .form__prompts > dd {
    margin: 0; }
  .ss-form .form__prompts li {
    display: inline-block;
    margin-top: 1rem;
    margin-right: 1.5rem; }
  .ss-form .form__prompts button {
    font-size: 1.6rem;
    line-height: 3.4rem;
    background-color: #fdb913;
    background-image: -webkit-linear-gradient(#fdb913, #faa21b);
    background-image: linear-gradient(#fdb913, #faa21b);
    display: inline-block;
    height: 3.4rem;
    padding: 0 23px;
    color: #ffffff !important;
    text-transform: none;
    border: none;
    vertical-align: middle;
    font-weight: 400;
    border-radius: .5rem;
    position: relative;
    /* Colors */
    background: transparent;
    border: 1px solid rgba(147, 149, 152, 0.5);
    color: #939598 !important;
    /* Size */
    /* Icon */
    /* Mouse Actions */
    color: #faa21b !important;
    opacity: 1; }
    .ss-form .form__prompts button[disabled] {
      opacity: .5; }
    .ss-form .form__prompts button.loading {
      opacity: 1;
      color: rgba(255, 255, 255, 0) !important; }
    .ss-form .form__prompts button[class*='icon']:before {
      margin-right: .5rem; }
    .ss-form .form__prompts button:active {
      top: 1px; }
    .ss-form .form__prompts button.active {
      background: #faa21b;
      color: #ffffff !important; }

.ss-form .form__checkbox label {
  display: inline-block; }

.ss-form .form__checkbox label.empty {
  display: block; }

.ss-form .form__submit {
  margin-top: 0 !important;
  padding-top: 3rem;
  padding-bottom: 0;
  border-top: 1px solid #e1e1e1; }
  .ss-form .form__submit::after {
    clear: both;
    content: "";
    display: table; }
  .ss-form .form__submit button {
    float: left; }
    .ss-form .form__submit button:last-child {
      float: right; }
  .ss-form .form__submit--combo {
    display: block; }
    .ss-form .form__submit--combo::after {
      clear: both;
      content: "";
      display: table; }
    .ss-form .form__submit--combo .submit__input {
      width: 70%;
      float: left; }
    .ss-form .form__submit--combo .submit__btn {
      width: 20%;
      float: right; }
    .ss-form .form__submit--combo .submit__error {
      clear: both;
      display: block;
      padding-top: 1rem; }
  .ss-form .form__submit--borderless {
    border: none; }

.ss-form .row {
  margin-bottom: 3rem; }
  .ss-form .row:last-child {
    margin-bottom: 0; }

.ss-form fieldset + .row,
.ss-form fieldset + fieldset {
  margin-top: 3rem; }

.ss-form label {
  display: block; }

.ss-form fieldset {
  margin: 0;
  padding: 0;
  border: none; }
  .ss-form fieldset[disabled='disabled'] {
    opacity: .5; }

.ss-loader {
  height: 75px;
  width: 75px;
  position: relative;
  top: 50%;
  margin: 0 auto; }
  .ss-loader span {
    height: 35px;
    width: 35px;
    -webkit-animation-name: loaderZoomDefault;
    -moz-animation-name: loaderZoomDefault;
    animation-name: loaderZoomDefault;
    -webkit-animation-delay: 0;
    -moz-animation-delay: 0;
    animation-delay: 0;
    -webkit-animation-duration: 2.5s;
    -moz-animation-duration: 2.5s;
    animation-duration: 2.5s;
    -webkit-animation-iteration-count: infinite;
    -moz-animation-iteration-count: infinite;
    animation-iteration-count: infinite;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both;
    position: absolute;
    display: block;
    background-color: #faa21b;
    border-radius: 50%; }
    .ss-loader span:nth-child(1) {
      top: 0;
      animation-delay: 0; }
    .ss-loader span:nth-child(2) {
      top: 0;
      left: 40px;
      animation-delay: -1.875s; }
    .ss-loader span:nth-child(4) {
      top: 40px;
      left: 40px;
      animation-delay: -1.25s; }
    .ss-loader span:nth-child(3) {
      top: 40px;
      animation-delay: -0.625s; }
  .ss-loader.loader--vert-center {
    -webkit-transform: translate(-50%, -50%);
    -moz-transform: translate(-50%, -50%);
    -ms-transform: translate(-50%, -50%);
    -o-transform: translate(-50%, -50%);
    transform: translate(-50%, -50%);
    position: absolute;
    left: 50%; }
  .ss-loader.ng-leave {
    transition: 0.2s linear all;
    opacity: 1; }
  .ss-loader.ng-leave.ng-leave-active {
    opacity: 0; }

@keyframes loaderZoomDefault {
  0% {
    -webkit-transform: scale(1);
    -moz-transform: scale(1);
    -ms-transform: scale(1);
    -o-transform: scale(1);
    transform: scale(1); }
  30% {
    -webkit-transform: scale(0);
    -moz-transform: scale(0);
    -ms-transform: scale(0);
    -o-transform: scale(0);
    transform: scale(0);
    background-color: #e1e1e1; }
  80% {
    background-color: #e1e1e1; }
  100% {
    -webkit-transform: scale(1);
    -moz-transform: scale(1);
    -ms-transform: scale(1);
    -o-transform: scale(1);
    transform: scale(1);
    background-color: #faa21b; } }

.ss-matrix .matrix {
  /* Matrix List */
  /* Matrix Actions / Buttons */
  /* Empty list paragraph styling */ }
  .ss-matrix .matrix__list {
    margin: 0;
    padding: 0;
    list-style: none; }
    .ss-matrix .matrix__list::after {
      clear: both;
      content: "";
      display: table; }
    .ss-matrix .matrix__list > li, .ss-matrix .matrix__list > dd {
      margin: 0; }
    .ss-matrix .matrix__list > li {
      font-size: 1.5rem;
      line-height: 1;
      display: block;
      padding: 1rem;
      border: 1px solid #e1e1e1;
      border-radius: 3px;
      cursor: move;
      cursor: -webkit-grab;
      position: relative; }
      .ss-matrix .matrix__list > li.sortable-chosen {
        cursor: -webkit-grabbing; }
      .ss-matrix .matrix__list > li + li {
        margin-top: .5rem; }
    .ss-matrix .matrix__list textarea {
      padding: 0 2.5rem 0 2.5rem;
      border: none; }
    .ss-matrix .matrix__list .list__title {
      font-weight: 500; }
    .ss-matrix .matrix__list .list__new-row {
      font-style: italic; }
    .ss-matrix .matrix__list .list__number {
      font-size: 1.4rem;
      line-height: 1;
      position: absolute;
      top: 0;
      bottom: 0;
      left: 0;
      width: 2.5rem;
      background: #f5f5f5;
      font-weight: 400;
      z-index: 2; }
      .ss-matrix .matrix__list .list__number span {
        -webkit-transform: translateY(-50%);
        -moz-transform: translateY(-50%);
        -ms-transform: translateY(-50%);
        -o-transform: translateY(-50%);
        transform: translateY(-50%);
        position: absolute;
        top: 50%;
        width: 100%;
        text-align: center; }
    .ss-matrix .matrix__list .list__actions {
      margin: 0;
      padding: 0;
      list-style: none;
      -webkit-transform: translateY(-50%);
      -moz-transform: translateY(-50%);
      -ms-transform: translateY(-50%);
      -o-transform: translateY(-50%);
      transform: translateY(-50%);
      position: absolute;
      top: 50%;
      right: 1rem; }
      .ss-matrix .matrix__list .list__actions::after {
        clear: both;
        content: "";
        display: table; }
      .ss-matrix .matrix__list .list__actions > li, .ss-matrix .matrix__list .list__actions > dd {
        margin: 0; }
      .ss-matrix .matrix__list .list__actions li {
        display: block;
        float: left;
        padding: 0 .5rem; }
  .ss-matrix .matrix__actions {
    margin: 0;
    padding: 0;
    list-style: none;
    margin-top: .5rem;
    text-align: right; }
    .ss-matrix .matrix__actions::after {
      clear: both;
      content: "";
      display: table; }
    .ss-matrix .matrix__actions > li, .ss-matrix .matrix__actions > dd {
      margin: 0; }
    .ss-matrix .matrix__actions li {
      display: inline-block; }
    .ss-matrix .matrix__actions button {
      background: none;
      border: none;
      margin: 0;
      padding: 0;
      font-size: inherit;
      line-height: inherit;
      font-size: 1.3rem;
      line-height: 1;
      padding: .5rem 1rem;
      border: 1px solid #e1e1e1;
      font-weight: 400;
      border-radius: 3px;
      position: relative; }
      .ss-matrix .matrix__actions button:active {
        top: 1px; }
  .ss-matrix .matrix__empty {
    font-style: italic; }

.ss-searchable__end {
  margin-top: 3rem; }
  .ss-searchable__end::after {
    clear: both;
    content: "";
    display: table; }
  .ss-searchable__end p {
    margin: 0;
    color: #939598; }
  .ss-searchable__end .end__finished p:first-child {
    float: left; }
  .ss-searchable__end .end__finished p:last-child {
    float: right; }
  .ss-searchable__end .end__loading {
    width: 100%;
    text-align: center; }
    .ss-searchable__end .end__loading::before {
      -webkit-animation: spin 1.2s infinite linear;
      -moz-animation: spin 1.2s infinite linear;
      animation: spin 1.2s infinite linear;
      margin-right: 1rem; }
  .ss-searchable__end.end--table {
    margin-top: 0;
    border-top: solid 1px #e1e1e1;
    padding-top: 2rem; }

.ss-sortable {
  font-size: 1.7rem;
  line-height: 1.625;
  margin-top: 1rem; }
  @media (min-width: 768px) {
    .ss-sortable {
      position: absolute;
      right: 0;
      bottom: 1.2rem;
      margin-top: 0;
      text-align: right; } }
  .ss-sortable a {
    font-weight: 400; }
  .ss-sortable li a {
    font-weight: 300; }
  .ss-sortable i {
    padding-left: .5rem; }

.ss-tag-list {
  margin: 1.5rem 0 0; }
  .ss-tag-list li {
    margin: 0 0.5rem 0.8rem 0;
    padding: 0.6rem 1.5rem;
    font-size: 1.6rem;
    line-height: 1;
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    display: inline-block;
    color: #4b4a4b;
    background: #ffffff;
    border: solid 1px #e1e1e1;
    border-radius: 5px;
    cursor: pointer; }
    .ss-tag-list li:hover {
      border-color: #faa21b; }
    .ss-tag-list li:hover .remove {
      color: #faa21b; }
    .ss-tag-list li input {
      display: none; }
    .ss-tag-list li label {
      position: relative; }
    .ss-tag-list li.active {
      color: #faa21b; }
      .ss-tag-list li.active label {
        padding-right: 2rem; }
      .ss-tag-list li.active .remove {
        display: inherit; }
    .ss-tag-list li .remove {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      position: absolute;
      right: 0;
      bottom: 0.2rem;
      display: none;
      color: #e1e1e1; }
      .ss-tag-list li .remove::after {
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: ""; }

.ss-tag-picker .picker__upper {
  margin-bottom: 3rem; }
  .ss-tag-picker .picker__upper .upper__search input {
    padding-left: 2.75rem;
    border-bottom: none; }
  .ss-tag-picker .picker__upper .upper__sort .ss-sortable {
    position: static;
    margin-top: .5rem;
    text-align: left; }
    @media (min-width: 768px) {
      .ss-tag-picker .picker__upper .upper__sort .ss-sortable {
        text-align: right; } }

.ss-tag-picker .picker__middle {
  position: relative; }
  .ss-tag-picker .picker__middle::after {
    position: absolute;
    bottom: 0;
    left: 0;
    content: '';
    width: 100%;
    height: 5em;
    background-image: linear-gradient(rgba(255, 255, 255, 0), #ffffff);
    pointer-events: none; }
  .ss-tag-picker .picker__middle .middle__tags {
    position: relative;
    height: 45rem;
    overflow: scroll; }
    .ss-tag-picker .picker__middle .middle__tags .picker__list {
      margin: 0 0 7.5rem;
      display: block; }
      .ss-tag-picker .picker__middle .middle__tags .picker__list--empty {
        position: absolute;
        top: 40%;
        right: 50%;
        -webkit-transform: translateY(-50%) translateX(50%);
        -moz-transform: translateY(-50%) translateX(50%);
        -ms-transform: translateY(-50%) translateX(50%);
        -o-transform: translateY(-50%) translateX(50%);
        transform: translateY(-50%) translateX(50%);
        text-align: center; }

.ss-tag-picker .picker__lower {
  padding-top: 2rem;
  min-height: 6.2rem;
  border-top: 1px solid #e1e1e1; }
  .ss-tag-picker .picker__lower .lower__selected {
    padding: 0.2rem 0 0; }
    .ss-tag-picker .picker__lower .lower__selected .selected__results {
      display: inline; }
      .ss-tag-picker .picker__lower .lower__selected .selected__results p {
        display: inline;
        margin-right: .5rem;
        line-height: 3rem; }
    .ss-tag-picker .picker__lower .lower__selected .picker__list::before {
      display: none; }
  .ss-tag-picker .picker__lower .lower__submit {
    padding: 0; }
    .ss-tag-picker .picker__lower .lower__submit button {
      float: right; }

.ss-tag-picker .picker__list {
  margin: 1.5rem 0 0;
  display: block; }
  .ss-tag-picker .picker__list li {
    margin: 0 0.5rem 0.8rem 0;
    padding: 0.6rem 1.5rem;
    font-size: 1.6rem;
    line-height: 1;
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    display: inline-block;
    color: #4b4a4b;
    background: #ffffff;
    border: solid 1px #e1e1e1;
    border-radius: 5px;
    cursor: pointer; }
    .ss-tag-picker .picker__list li:hover {
      border-color: #faa21b; }
    .ss-tag-picker .picker__list li:hover .remove {
      color: #faa21b; }
    .ss-tag-picker .picker__list li input {
      display: none; }
    .ss-tag-picker .picker__list li label {
      position: relative; }
    .ss-tag-picker .picker__list li.active {
      color: #faa21b; }
      .ss-tag-picker .picker__list li.active label {
        padding-right: 2rem; }
      .ss-tag-picker .picker__list li.active .remove {
        display: inherit; }
    .ss-tag-picker .picker__list li .remove {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      position: absolute;
      right: 0;
      bottom: 0.2rem;
      display: none;
      color: #e1e1e1; }
      .ss-tag-picker .picker__list li .remove::after {
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: ""; }
  @media (min-width: 768px) {
    .ss-tag-picker .picker__list {
      display: inline; } }

ss-video {
  /* Todo: Override all flowplayer colors with theme colors */ }
  ss-video .ss-video-container {
    position: relative;
    line-height: 0; }
    ss-video .ss-video-container > * {
      line-height: 1.625; }
  ss-video .flowplayer .ss-color {
    color: #ffa200 !important; }
  ss-video .flowplayer-load-button {
    position: absolute;
    top: 0;
    right: 0;
    bottom: 0;
    left: 0;
    display: block;
    width: 100%;
    padding: 0;
    background: transparent;
    color: transparent;
    border: none;
    line-height: 0; }
  @media print {
    ss-video {
      display: none; } }

.standards-navigator {
  padding-top: 3rem; }
  .standards-navigator .icon-search {
    padding-left: 10px; }
  .standards-navigator .input__text[class*='icon']:before {
    left: auto; }
  .standards-navigator input[type="search"] {
    font-size: 1.9rem;
    padding: .5rem 0; }
  .standards-navigator .ss-loader {
    margin-top: 100px; }
  .standards-navigator .type-selector {
    padding: 0 15px;
    width: 90%; }
  .standards-navigator table.grades-selector {
    width: 80px;
    text-align: center;
    float: left;
    margin-top: 42px; }
    .standards-navigator table.grades-selector td {
      height: 80px;
      cursor: pointer;
      border: 1px solid lightgrey; }
      .standards-navigator table.grades-selector td.active {
        background-color: lightgrey; }
  .standards-navigator .standards-navigator-header {
    padding-bottom: 20px; }
  .standards-navigator .standards-instructions {
    text-align: center;
    padding-top: 300px; }
  .standards-navigator div.standards-tree-container {
    max-width: calc(100% - 85px);
    width: calc(100% - 85px);
    margin-left: 85px; }
    .standards-navigator div.standards-tree-container table.standards-tree {
      width: 100%;
      max-width: 100%; }
      .standards-navigator div.standards-tree-container table.standards-tree th:first-child, .standards-navigator div.standards-tree-container table.standards-tree td:first-child {
        line-height: 1.2; }
      .standards-navigator div.standards-tree-container table.standards-tree th, .standards-navigator div.standards-tree-container table.standards-tree td {
        padding: 10px;
        font-size: 1.9rem;
        line-height: 1.9rem;
        height: 40px; }
      .standards-navigator div.standards-tree-container table.standards-tree .searchCell {
        padding: 0;
        text-align: center;
        width: 32px; }
      .standards-navigator div.standards-tree-container table.standards-tree .codeCell {
        width: 140px;
        padding: 0;
        text-align: center; }
      .standards-navigator div.standards-tree-container table.standards-tree th {
        border-right: 1px solid transparent;
        border-left: 1px solid transparent; }
      .standards-navigator div.standards-tree-container table.standards-tree td {
        border: 1px solid lightgrey; }
      .standards-navigator div.standards-tree-container table.standards-tree tr.level-1 td:first-child {
        padding-left: 40px; }
      .standards-navigator div.standards-tree-container table.standards-tree tr.level-2 td:first-child {
        padding-left: 80px; }
      .standards-navigator div.standards-tree-container table.standards-tree tr.level-3 td:first-child {
        padding-left: 120px; }
      .standards-navigator div.standards-tree-container table.standards-tree tr.level-4 td:first-child {
        padding-left: 160px; }

.standards-view ul {
  margin: 0; }

.standards__description {
  margin: 0;
  padding: 0;
  list-style: none;
  font-size: 1.5rem;
  line-height: 1.625;
  font-weight: 300; }
  .standards__description::after {
    clear: both;
    content: "";
    display: table; }
  .standards__description > li, .standards__description > dd {
    margin: 0; }
  .standards__description li {
    padding-bottom: 1.5rem; }
    .standards__description li:last-child {
      padding-bottom: 0; }
    .standards__description li strong {
      color: #4b4a4b;
      font-weight: 500; }
    .standards__description li p {
      margin: 0; }

.standards__instructions div:first-child strong {
  margin-top: 0; }

.standards__instructions div strong {
  display: block;
  margin-top: 1.5rem; }

.state-overlay {
  height: 100%;
  width: 100%;
  padding: 0; }
  .state-overlay .ngdialog-content {
    -webkit-animation-name: zoomIn;
    -moz-animation-name: zoomIn;
    animation-name: zoomIn;
    -webkit-animation-delay: 0;
    -moz-animation-delay: 0;
    animation-delay: 0;
    -webkit-animation-duration: 0.5s;
    -moz-animation-duration: 0.5s;
    animation-duration: 0.5s;
    -webkit-animation-fill-mode: both;
    -moz-animation-fill-mode: both;
    animation-fill-mode: both;
    position: absolute;
    top: 2rem;
    right: 2rem;
    bottom: 2rem;
    left: 2rem;
    width: auto;
    max-width: none;
    box-shadow: 0 0 25px rgba(28, 28, 28, 0.5); }
  .state-overlay .overlay {
    display: -webkit-box;
    display: -moz-box;
    display: box;
    display: -webkit-flex;
    display: -moz-flex;
    display: -ms-flexbox;
    display: flex;
    -webkit-box-orient: vertical;
    -moz-box-orient: vertical;
    box-orient: vertical;
    -webkit-flex-direction: column;
    -moz-flex-direction: column;
    flex-direction: column;
    -ms-flex-direction: column;
    height: 100%; }
    .state-overlay .overlay__head {
      border-bottom: 1px solid #e1e1e1; }
    .state-overlay .overlay__body {
      -webkit-box-flex: 2;
      -moz-box-flex: 2;
      box-flex: 2;
      -webkit-flex: 2;
      -moz-flex: 2;
      -ms-flex: 2;
      flex: 2;
      padding: 0;
      position: relative; }
    .state-overlay .overlay__actions {
      position: absolute;
      left: 2.5rem;
      z-index: 2; }
      @media (max-width: 767px) {
        .state-overlay .overlay__actions {
          display: none; } }
    .state-overlay .overlay__actions-right {
      z-index: 1;
      right: 5.5rem !important; }
      .state-overlay .overlay__actions-right button:first-child {
        float: right; }
    .state-overlay .overlay iframe, .state-overlay .overlay embed {
      height: 100%;
      width: 100%;
      border: none; }
  .state-overlay te-wrap {
    height: 100%;
    width: 100%;
    position: absolute; }
    .state-overlay te-wrap .te-wrap-container {
      position: absolute;
      top: 0;
      right: 0;
      bottom: 0;
      left: 0; }
    .state-overlay te-wrap > div,
    .state-overlay te-wrap ng-transclude,
    .state-overlay te-wrap ng-transclude > * {
      height: 100%;
      width: 100%; }

@media only screen and (max-height: 800px) {
  .sticky-wrapper {
    height: auto !important; } }

[sticky] {
  position: static; }
  @media only screen and (min-width: 768px) and (min-height: 800px) {
    [sticky].stuck {
      position: fixed;
      width: 100%;
      z-index: 101; } }

@media only screen and (min-width: 768px) and (min-height: 800px) {
  .container [sticky].stuck {
    width: calc(100% - 5rem); } }

.sticky-headline.stuck .headline {
  margin-bottom: 0; }

.container [sticky].stuck {
  max-width: 1100px; }

.container--breakout--active [sticky].stuck {
  max-width: 536px; }
  @media (max-width: 1149px) {
    .container--breakout--active [sticky].stuck {
      max-width: 46%; } }

.subnav {
  background: -webkit-linear-gradient(#939598, #939598);
  background: linear-gradient(#939598, #939598);
  clear: both;
  height: 3.5rem;
  line-height: 3.5rem;
  color: #ffffff; }
  .subnav::after {
    clear: both;
    content: "";
    display: table; }
  @media print {
    .subnav {
      display: none; } }
  @media (max-width: 767px) {
    .subnav {
      position: fixed;
      top: 5.5rem;
      width: 100%;
      z-index: 101; } }
  @media (max-width: 767px) {
    .hide-subnav-on-mobile .subnav {
      display: none; } }
  .subnav li, .subnav li + li {
    display: block; }
  .subnav a {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    font-size: 1.5rem;
    line-height: 3.5rem;
    display: block;
    color: #ffffff;
    text-transform: uppercase;
    font-weight: 700;
    position: relative; }
    @media (max-width: 767px) {
      .subnav a {
        font-size: 1.4rem; } }
  .subnav__left {
    margin: 0;
    padding: 0;
    list-style: none;
    float: left; }
    .subnav__left::after {
      clear: both;
      content: "";
      display: table; }
    .subnav__left > li, .subnav__left > dd {
      margin: 0; }
    @media (max-width: 767px) {
      .subnav__left {
        display: none; } }
    .subnav__left li {
      float: left; }
      .subnav__left li a, .subnav__left li span {
        display: inline-block; }
      .subnav__left li span {
        padding: 0 1.25rem;
        font-weight: 700;
        font-size: 60%;
        vertical-align: top; }
      .subnav__left li:last-child span {
        display: none; }
  .subnav__right {
    margin: 0;
    padding: 0;
    list-style: none;
    float: right; }
    .subnav__right::after {
      clear: both;
      content: "";
      display: table; }
    .subnav__right > li, .subnav__right > dd {
      margin: 0; }
    .subnav__right li, .subnav__right li + li {
      margin-right: 0.5rem;
      margin-left: 0.5rem;
      float: left; }
    .subnav__right li:first-child {
      margin-right: 0; }
    .subnav__right a {
      padding-right: 1rem;
      padding-left: 1rem; }
      .subnav__right a:after {
        position: absolute;
        right: 0;
        bottom: 0;
        left: 50%;
        height: 0;
        width: 0;
        border-bottom: 0.5rem solid #f5f5f5;
        border-left: 0.5rem solid transparent;
        border-right: 0.5rem solid transparent;
        content: '';
        opacity: 0;
        margin-left: -.5rem; }
      .subnav__right a.active:after {
        opacity: 1; }
  .subnav--messaging {
    font-size: 1.5rem; }

.summary {
  padding: 3rem 2.5rem;
  background: #f5f5f5;
  border-radius: 5px;
  margin-bottom: 2.5rem; }
  @media (min-width: 768px) {
    .summary {
      padding: 2rem 3rem; } }
  .summary .summary__list {
    margin: 0;
    padding: 0;
    list-style: none; }
    .summary .summary__list::after {
      clear: both;
      content: "";
      display: table; }
    .summary .summary__list > li, .summary .summary__list > dd {
      margin: 0; }
    .summary .summary__list dt {
      color: rgba(28, 28, 28, 0.5);
      margin-top: 3rem; }
      .summary .summary__list dt:first-child {
        margin-top: 0; }
    .summary .summary__list dd {
      color: #1c1c1c; }
    .summary .summary__list strong {
      font-weight: 500; }

.tab-mode-keyboard-help {
  display: none; }

.tab-mode-enabled *:focus {
  outline: 5px solid #00abe6 !important;
  outline: 5px auto -webkit-focus-ring-color !important; }

.tab-mode-enabled .tab-mode-keyboard-help {
  display: block; }

.te-wrap-container {
  display: flex;
  position: relative; }
  @media (min-width: 768px) {
    .te-wrap-container.allow-flex .te-wrap {
      position: relative;
      top: auto;
      right: auto;
      bottom: auto;
      left: auto; } }
  @media (min-width: 768px) {
    .te-wrap-container.allow-flex .te-wrap.active {
      max-width: 300px; } }
  .te-wrap-container ng-transclude {
    flex-grow: 1; }

.te-wrap {
  -webkit-transition: max-width 0.3s;
  -moz-transition: max-width 0.3s;
  transition: max-width 0.3s;
  position: absolute;
  top: 0;
  right: 0;
  bottom: 0;
  left: auto;
  width: 100%;
  max-width: 0;
  border-left: 6px solid #00abe6;
  z-index: 100; }
  .te-wrap.active {
    max-width: 300px; }
    @media (min-width: 768px) {
      .te-wrap.active {
        max-width: 450px; } }
  .te-wrap .wrap__nav {
    opacity: 0; }
  .te-wrap .wrap__content {
    position: absolute;
    top: 0;
    bottom: 0;
    height: 100%;
    width: 100%;
    -webkit-transition: opacity 0.3s;
    -moz-transition: opacity 0.3s;
    transition: opacity 0.3s;
    padding-top: 4rem;
    background: #ffffff;
    opacity: 0;
    overflow: scroll; }
    .te-wrap .wrap__content .uploaded-image {
      position: relative;
      max-width: 40rem; }
      .te-wrap .wrap__content .uploaded-image-opener {
        position: absolute;
        top: 1.5rem;
        right: 1.5rem;
        -webkit-transition: all 0.15s ease-in-out;
        -moz-transition: all 0.15s ease-in-out;
        transition: all 0.15s ease-in-out;
        font-size: 3rem;
        line-height: 1;
        display: block;
        z-index: 2;
        opacity: 0; }
        .te-wrap .wrap__content .uploaded-image-opener:before {
          font-family: "ss-icons";
          width: auto;
          margin: 0;
          font-style: normal;
          font-weight: normal;
          speak: none;
          display: inline-block;
          text-decoration: inherit;
          line-height: 1em;
          text-align: center;
          font-variant: normal;
          text-transform: none;
          vertical-align: middle;
          position: relative;
          top: -1px;
          text-rendering: optimizeLegibility;
          content: "";
          color: #faa21b; }
      .te-wrap .wrap__content .uploaded-image:hover .uploaded-image-opener {
        opacity: 1.0; }
  .te-wrap .wrap__toggle {
    font-size: 1.6rem;
    line-height: 3.4rem;
    background-color: #fdb913;
    background-image: -webkit-linear-gradient(#fdb913, #faa21b);
    background-image: linear-gradient(#fdb913, #faa21b);
    display: inline-block;
    height: 3.4rem;
    padding: 0 23px;
    color: #ffffff !important;
    text-transform: none;
    border: none;
    vertical-align: middle;
    font-weight: 400;
    border-radius: .5rem;
    position: relative;
    /* Colors */
    /* Size */
    /* Icon */
    /* Mouse Actions */
    position: absolute;
    top: 36rem;
    right: auto;
    bottom: auto;
    left: -11rem;
    -webkit-transform: rotate(-90deg);
    -moz-transform: rotate(-90deg);
    -ms-transform: rotate(-90deg);
    -o-transform: rotate(-90deg);
    transform: rotate(-90deg);
    border-bottom-left-radius: 0;
    border-bottom-right-radius: 0;
    background: #00abe6;
    white-space: nowrap; }
    .te-wrap .wrap__toggle[disabled] {
      opacity: .5; }
    .te-wrap .wrap__toggle.loading {
      opacity: 1;
      color: rgba(255, 255, 255, 0) !important; }
    .te-wrap .wrap__toggle[class*='icon']:before {
      margin-right: .5rem; }
    .te-wrap .wrap__toggle:after {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      margin-left: .5rem; }
    .te-wrap .wrap__toggle i {
      opacity: .5;
      margin-left: .5rem; }
  .te-wrap.active .wrap__nav, .te-wrap.active .wrap__content {
    opacity: 1; }
  .te-wrap.active .wrap__toggle:after {
    font-family: "ss-icons";
    content: ""; }
  .te-wrap h2 {
    font-size: 1.7rem;
    line-height: 1.625;
    padding: 1rem 2rem 0;
    border-top: 1px solid #f5f5f5; }
    .te-wrap h2:first-child {
      border-top: none; }
  .te-wrap table {
    font-size: 1.5rem;
    line-height: 1.625;
    display: block;
    border: none; }
    .te-wrap table thead {
      display: none; }
    .te-wrap table tbody tr td {
      padding: 0 2rem;
      border: none; }
    .te-wrap table tbody tr h4 {
      font-size: 1.5rem;
      line-height: 1.625;
      font-weight: 600;
      margin-top: 1rem; }
    .te-wrap table tbody tr ol {
      margin-bottom: 0; }
    .te-wrap table table tbody tr td {
      border: solid 1px #e1e1e1; }
  .te-wrap .inline-state-nav {
    position: absolute;
    top: 0;
    right: auto;
    bottom: auto;
    left: auto;
    width: 100%;
    margin: 0;
    background-color: #ffffff;
    z-index: 1; }
    .te-wrap .inline-state-nav li {
      width: 50%;
      text-align: center;
      font-size: 1.4rem; }
      .te-wrap .inline-state-nav li a {
        padding-right: 0;
        padding-left: 0; }
      .te-wrap .inline-state-nav li.active {
        border-color: #00abe6; }
  .te-wrap .single .inline-state-nav li {
    width: 100%;
    font-weight: 500; }

.tipsy.large-white .tipsy-inner {
  font-size: 1.5rem;
  line-height: 1.625;
  color: #1c1c1c;
  font-weight: 300;
  background: #ffffff;
  max-width: 430px;
  border: 1px solid #e1e1e1;
  border-radius: 5px;
  box-shadow: 0 1px 3px 0 rgba(28, 28, 28, 0.1); }

.tipsy.large-white .tipsy-arrow {
  height: 1rem;
  width: 1rem;
  background: #ffffff;
  border: solid #e1e1e1;
  border-width: 1px 1px 0 0; }
  .tipsy.large-white .tipsy-arrow.tipsy-arrow-s {
    -webkit-transform: rotate(135deg);
    -moz-transform: rotate(135deg);
    -ms-transform: rotate(135deg);
    -o-transform: rotate(135deg);
    transform: rotate(135deg); }

.toggle-view {
  margin-top: 1rem; }
  .toggle-view::after {
    clear: both;
    content: "";
    display: table; }
  @media (min-width: 768px) {
    .toggle-view {
      position: absolute;
      top: 1rem;
      right: 0;
      margin-top: 0; } }
  .toggle-view button {
    padding: 0 1rem;
    display: block;
    height: 3rem;
    line-height: 3rem;
    float: left; }
    @media (min-width: 768px) {
      .toggle-view button span {
        font-size: 0; } }
    .toggle-view button i {
      margin-right: .5rem; }
      @media (min-width: 768px) {
        .toggle-view button i {
          display: block;
          margin-right: 0; } }
    .toggle-view button:hover i, .toggle-view button.active i, .toggle-view button:hover span, .toggle-view button.active span {
      -webkit-transition: color 1s ease;
      -moz-transition: color 1s ease;
      transition: color 1s ease;
      color: #f77e0d; }
    .toggle-view button:first-child {
      border-bottom-right-radius: 0;
      border-top-right-radius: 0; }
    .toggle-view button:last-child {
      border-bottom-left-radius: 0;
      border-top-left-radius: 0;
      border-left: none; }
    @media (min-width: 768px) {
      .toggle-view button {
        height: 2.5rem;
        line-height: 2.5rem; } }

.ui-datepicker {
  -webkit-user-select: none;
  -moz-user-select: none;
  -ms-user-select: none;
  user-select: none;
  font-size: 1.5rem;
  line-height: 1.625;
  display: none;
  min-width: 222px;
  margin: 0 1px 10px;
  border-radius: 3px;
  padding: 0 14px;
  padding: 10px;
  overflow: auto;
  padding: 0;
  background: #ffffff;
  box-shadow: 0 0 0 1px rgba(0, 0, 20, 0.1), 0 5px 20px rgba(0, 0, 0, 0.25);
  z-index: 901 !important; }
  .ui-datepicker-header {
    padding: 8px 8px 4px; }
  .ui-datepicker-prev {
    float: left; }
  .ui-datepicker-next {
    float: right; }
  .ui-datepicker-title {
    text-align: center; }
  .ui-datepicker-calendar {
    font-size: 1.3rem;
    line-height: 1.625; }
    .ui-datepicker-calendar th, .ui-datepicker-calendar td {
      padding: 2px; }
      .ui-datepicker-calendar th:first-child, .ui-datepicker-calendar td:first-child {
        padding-left: 8px; }
      .ui-datepicker-calendar th:last-child, .ui-datepicker-calendar td:last-child {
        padding-right: 8px; }
    .ui-datepicker-calendar span, .ui-datepicker-calendar td a {
      display: block;
      width: 26px;
      line-height: 26px;
      text-align: center;
      color: #1c1c1c;
      border-radius: 2px; }
    .ui-datepicker-calendar th span {
      color: #939598;
      font-weight: normal; }
    .ui-datepicker-calendar td a:hover {
      background: #e1e1e1;
      text-decoration: none; }
    .ui-datepicker-calendar td .ui-state-active {
      background: #939598;
      color: #ffffff;
      cursor: default; }
    .ui-datepicker-calendar td.ui-datepicker-today a {
      border-radius: 13px;
      -webkit-box-shadow: inset 0 0 0 2px rgba(0, 0, 0, 0.15);
      -moz-box-shadow: inset 0 0 0 2px rgba(0, 0, 0, 0.15);
      box-shadow: inset 0 0 0 2px rgba(0, 0, 0, 0.15); }
    .ui-datepicker-calendar td.ui-state-disabled {
      opacity: .3; }
  .ui-datepicker .ui-state-hover {
    background: #e1e1e1;
    text-decoration: none; }

.unit-list {
  margin: 0;
  padding: 0;
  list-style: none;
  display: block;
  clear: both;
  display: block;
  position: relative;
  margin-left: -12px;
  margin-right: -12px; }
  .unit-list::after {
    clear: both;
    content: "";
    display: table; }
  .unit-list > li, .unit-list > dd {
    margin: 0; }
  .unit-list::after {
    clear: both;
    content: "";
    display: table; }
  .unit-list > * {
    float: left;
    display: block;
    margin-right: 3.84615%;
    width: 100%;
    width: 100%;
    padding-left: 12px;
    padding-right: 12px;
    margin-right: 0; }
    .unit-list > *:last-child {
      margin-right: 0; }
    @media print {
      .unit-list > * {
        float: left !important; } }
  @media (max-width: 767px) {
    .unit-list {
      margin-left: 0;
      margin-right: 0; } }
  .unit-list > li {
    margin-top: 2.5rem; }
    .unit-list > li:first-child {
      margin-top: 0; }
    @media (min-width: 768px) {
      .unit-list > li {
        float: left;
        display: block;
        margin-right: 3.84615%;
        width: 48.07692%;
        width: 50%;
        padding-left: 12px;
        padding-right: 12px;
        margin-right: 0; }
        .unit-list > li:last-child {
          margin-right: 0; } }
  @media print and (min-width: 768px) {
    .unit-list > li {
      float: left !important; } }
    @media (min-width: 768px) {
        .unit-list > li:nth-child(2n + 1) {
          clear: left; }
        .unit-list > li:nth-child(-n + 2) {
          margin-top: 0; } }
  .unit-list .unit__headline {
    font-weight: 300;
    font-size: 2.4rem;
    line-height: 2.7rem;
    margin-bottom: .5rem; }
  .unit-list .unit__image {
    position: relative;
    height: 0;
    padding-bottom: 44.61%;
    overflow: hidden;
    margin-bottom: 1rem; }
    .unit-list .unit__image .image__actions {
      position: absolute;
      bottom: 1rem;
      width: 100%; }
      .unit-list .unit__image .image__actions button {
        display: block;
        margin-left: 1rem; }
        @media (min-width: 1150px) {
          .unit-list .unit__image .image__actions button {
            width: 47%; } }
      .unit-list .unit__image .image__actions button + button {
        margin-top: 1rem; }
    .unit-list .unit__image img {
      position: absolute;
      top: 0;
      right: 0;
      bottom: 0;
      left: 0;
      height: 100%;
      width: 100%; }
  .unit-list .file-list > li {
    display: block; }

.warning {
  padding: 2rem;
  margin-top: 2rem;
  background-color: #ffffff;
  border-radius: 4px;
  border: solid 1px #e1e1e1; }
  .warning .warning__icon, .warning .warning__description {
    margin: 0; }
  .warning .warning__icon {
    float: left;
    margin-right: 1rem;
    clear: both;
    color: #faa21b; }
  .warning .warning__description {
    overflow: auto;
    display: block; }

.welcome-panel {
  margin-bottom: 7rem;
  padding: 0; }
  .welcome-panel .welcome__headline {
    margin-bottom: 3rem; }
  .welcome-panel .headline--strikethrough {
    margin-right: auto;
    margin-left: auto;
    max-width: 78rem; }

.window-height {
  min-height: 100vh; }

.work__section {
  margin-top: 3rem;
  padding-top: 0;
  padding-bottom: 3rem;
  border-bottom: 1px solid #e1e1e1; }
  .work__section:first-child {
    margin-top: 0; }
  .work__section:last-child {
    padding-bottom: 0;
    border-bottom: none; }
  .work__section .section__headline {
    margin-bottom: 2rem; }
    .work__section .section__headline.headline--small {
      margin-bottom: 1rem; }
    .work__section .section__headline strong {
      font-weight: 500; }
    .work__section .section__headline .headline__actions {
      float: right; }
    .work__section .section__headline .meta__expand:after {
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      margin-left: .5rem;
      opacity: .7; }
  .work__section .section__body .headline--large {
    font-weight: 400;
    font-size: 1.9rem;
    line-height: 2.2rem; }
  .work__section .section__body .redactor-box, .work__section .section__body .body__content {
    margin: 1rem 0; }
  .work__section .section__meta {
    margin: 0;
    font-size: 1.4rem; }

.work__response {
  border-left: 4px solid #e1e1e1;
  padding-left: 2rem; }

.work__thinks {
  margin: 0;
  padding: 0;
  list-style: none; }
  .work__thinks::after {
    clear: both;
    content: "";
    display: table; }
  .work__thinks > li, .work__thinks > dd {
    margin: 0; }
  .work__thinks li + li {
    margin-top: 4rem; }
  .work__thinks .think__question {
    font-size: 1.5rem;
    line-height: 1.625;
    font-weight: 500;
    margin-bottom: 2rem; }

.work [sticky].stuck {
  width: inherit;
  max-width: 53.8rem;
  margin-right: 2.5rem; }

.alerts-list {
  margin: 0;
  padding: 0;
  list-style: none; }
  .alerts-list::after {
    clear: both;
    content: "";
    display: table; }
  .alerts-list > li, .alerts-list > dd {
    margin: 0; }
  .alerts-list > li + li {
    border-top: 1px solid #e1e1e1;
    margin-top: 3rem;
    padding-top: 3rem; }
  .alerts-list ul {
    list-style: disc;
    margin: 1em 0; }
  .alerts-list section {
    padding-top: 2rem;
    padding-bottom: 2rem; }
  .alerts-list .ss-form .form__submit {
    padding-top: 0; }

.extq__blanks textarea, .extq__chart .extq__input, .extq__blanks input {
  display: inline-block;
  background: rgba(0, 171, 230, 0.08);
  border: none;
  font-size: inherit;
  line-height: inherit;
  border: solid rgba(0, 171, 230, 0.4);
  border-width: 0 0 1px 0;
  padding: 0 .4rem;
  border-radius: .2rem; }

.extq__blanks textarea, .extq__chart .extq__input {
  display: block;
  border-width: 1px;
  width: 100%;
  resize: none; }

/* Fill in the Blanks / Multi Choice */
.extq__blanks .extq__segment,
.extq__multichoice .extq__segment {
  font-size: 1.3rem;
  line-height: 1.625;
  margin: .5rem 0 .8rem; }
  .extq__blanks .extq__segment:last-child,
  .extq__multichoice .extq__segment:last-child {
    margin-bottom: 2.5rem; }

.extq__blanks.singular,
.extq__multichoice.singular {
  padding: 0;
  list-style: none; }

.extq__blanks.teacher-mode {
  padding-left: 4.5rem; }

.extq__blanks li {
  position: relative; }

.extq__blanks textarea {
  margin-top: .5rem; }

.extq__blanks .extq__validator-mark {
  position: absolute;
  left: -4.5rem;
  top: auto; }

.extq__blanks .extq__input--small {
  min-width: 7rem;
  width: 7rem; }

.extq__blanks .extq__input--medium {
  min-width: 12rem;
  width: 12rem; }

.extq__blanks .extq__input--large {
  min-width: 15rem;
  width: 15rem; }

.extq__blanks-copy-btn {
  position: absolute;
  top: 0;
  right: 0; }

.extq__blanks-copyable {
  margin-right: 75px; }

.extq__multichoice input {
  display: block;
  visibility: visible;
  z-index: inherit;
  position: absolute;
  left: 0; }

.extq__multichoice label {
  display: block;
  padding-left: 2rem;
  position: relative; }

.extq__multichoice table {
  border: solid 1px #e1e1e1;
  margin-bottom: 2rem; }
  .extq__multichoice table td {
    padding: 2rem; }

.extq__multichoice .isCorrect {
  color: #92af2b; }
  @media print {
    .extq__multichoice .isCorrect * {
      color: #92af2b !important; } }

.extq__multichoice .isIncorrect {
  color: #da5450; }
  @media print {
    .extq__multichoice .isIncorrect * {
      color: #da5450 !important; } }

.extq__multichoice .multichoice__answer {
  display: block; }

.extq__multichoice .multichoice__explanation {
  display: block;
  border-left: 4px solid #e1e1e1;
  padding-left: 1rem; }

.extq__draggablesHeadline {
  font-size: 1.7rem;
  line-height: 2.4rem;
  font-weight: 400; }

.extq__panel {
  padding: 2rem;
  background-color: #f5f5f5;
  margin-bottom: 2rem;
  border-radius: 4px; }

.extq__answerkeys {
  margin: 2rem 0 0 0; }

.extq__grading {
  padding: 2rem;
  margin-top: 2rem;
  background-color: #ffffff;
  border-radius: 4px;
  border: solid 1px #e1e1e1; }
  .extq__grading i, .extq__grading p {
    display: inline-block;
    margin: 0; }
  .extq__grading .grading__icon {
    float: left;
    margin-right: 1rem;
    clear: both; }
    .extq__grading .grading__icon.icon-attention {
      color: #faa21b; }
  .extq__grading .grading__description {
    overflow: auto;
    display: block; }
  .extq__grading .grading__score {
    text-align: right; }

.extq__empty {
  font-size: 70%;
  opacity: .5;
  font-style: italic; }

/* Draggables */
.extq__draggables {
  margin: 0;
  padding: 0;
  list-style: none;
  font-size: 1.5rem;
  line-height: 1.625; }
  .extq__draggables::after {
    clear: both;
    content: "";
    display: table; }
  .extq__draggables > li, .extq__draggables > dd {
    margin: 0; }
  .extq__draggables li, .extq__draggables li + li {
    -webkit-transition: background-color, border-color, color 0.15s ease-in-out;
    -moz-transition: background-color, border-color, color 0.15s ease-in-out;
    transition: background-color, border-color, color 0.15s ease-in-out;
    display: inline-block;
    margin: .5rem 1rem .5rem 0;
    border: 1px solid #00abe6;
    border-radius: .2rem;
    padding: .6rem 1rem .7rem 1.8rem;
    position: relative;
    cursor: -webkit-grab;
    height: auto !important;
    width: auto !important; }
    .extq__draggables li:before, .extq__draggables li + li:before {
      position: absolute;
      top: .6rem;
      bottom: .8rem;
      left: .4rem;
      width: .6rem;
      background: repeat-y;
      content: '';
      background-image: url("data:image/svg+xml;base64,PD94bWwgdmVyc2lvbj0iMS4wIiBlbmNvZGluZz0idXRmLTgiPz4NCjwhLS0gR2VuZXJhdG9yOiBBZG9iZSBJbGx1c3RyYXRvciAxNi4wLjAsIFNWRyBFeHBvcnQgUGx1Zy1JbiAuIFNWRyBWZXJzaW9uOiA2LjAwIEJ1aWxkIDApICAtLT4NCjwhRE9DVFlQRSBzdmcgUFVCTElDICItLy9XM0MvL0RURCBTVkcgMS4xLy9FTiIgImh0dHA6Ly93d3cudzMub3JnL0dyYXBoaWNzL1NWRy8xLjEvRFREL3N2ZzExLmR0ZCI+DQo8c3ZnIHZlcnNpb249IjEuMSIgaWQ9IkxheWVyXzEiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyIgeG1sbnM6eGxpbms9Imh0dHA6Ly93d3cudzMub3JnLzE5OTkveGxpbmsiIHg9IjBweCIgeT0iMHB4Ig0KCSB3aWR0aD0iNnB4IiBoZWlnaHQ9IjRweCIgdmlld0JveD0iMCAwIDYgNCIgZW5hYmxlLWJhY2tncm91bmQ9Im5ldyAwIDAgNiA0IiB4bWw6c3BhY2U9InByZXNlcnZlIj4NCjxnPg0KCTxnPg0KCQk8cGF0aCBmaWxsLXJ1bGU9ImV2ZW5vZGQiIGNsaXAtcnVsZT0iZXZlbm9kZCIgZmlsbD0iI0E0QTRBNCIgZD0iTTQsNmgyVjRINFY2eiBNNCwwdjJoMlYwSDR6IE0wLDZoMlY0SDBWNnogTTAsMmgyVjBIMFYyeiBNNCwxMA0KCQkJaDJWOEg0VjEweiBNMCwxMGgyVjhIMFYxMHogTTQsMThoMnYtMkg0VjE4eiBNNCwxNGgydi0ySDRWMTR6IE0wLDE4aDJ2LTJIMFYxOHogTTAsMTRoMnYtMkgwVjE0eiBNNCwyMmgydi0ySDRWMjJ6IE0wLDIyaDJ2LTJIMA0KCQkJVjIyeiBNNCwzMGgydi0ySDRWMzB6IE00LDI2aDJ2LTJINFYyNnogTTAsMzBoMnYtMkgwVjMweiBNMCwyNmgydi0ySDBWMjZ6Ii8+DQoJPC9nPg0KPC9nPg0KPC9zdmc+DQo="); }
    .extq__draggables li:active, .extq__draggables li + li:active {
      box-shadow: 0 0 0 1px #00abe6;
      cursor: -webkit-grabbing;
      z-index: 999; }
    .extq__draggables li p, .extq__draggables li + li p {
      margin: 0; }
  .extq__draggables img {
    height: 7.5rem;
    width: 7.5rem; }
  .extq__draggables .extq__draggables-image {
    line-height: 0; }
    .extq__draggables .extq__draggables-image:active {
      -webkit-transition: -webkit-transform 200ms ease-in-out;
      -moz-transition: -moz-transform 200ms ease-in-out;
      transition: transform 200ms ease-in-out;
      -webkit-transform: scale3d(2.66, 2.66, 2.66);
      -moz-transform: scale3d(2.66, 2.66, 2.66);
      -ms-transform: scale3d(2.66, 2.66, 2.66);
      -o-transform: scale3d(2.66, 2.66, 2.66);
      transform: scale3d(2.66, 2.66, 2.66); }
  .extq__draggables .ui-draggable-dragging img {
    opacity: .65; }

/* Chart */
table.extq__chart {
  margin-bottom: 2rem; }

.extq__chart {
  border: none;
  table-layout: fixed;
  padding-top: 1rem; }
  .extq__chart th, .extq__chart td {
    vertical-align: top;
    border: 1px dotted #939598;
    min-width: 33.33333%;
    max-width: 50%; }
    .extq__chart th:first-child, .extq__chart td:first-child {
      border-left: none; }
    .extq__chart th:last-child, .extq__chart td:last-child {
      border-right: none; }
  .extq__chart th {
    border-top: 0;
    height: 3rem;
    padding: .5rem 1.5rem;
    font-weight: 600;
    vertical-align: bottom; }
    .extq__chart th:last-child {
      width: 10rem; }
    .extq__chart th p {
      margin: 0; }
  .extq__chart.extq__chart--2 th {
    width: 50%; }
  .extq__chart.extq__chart--3 th {
    width: 33.33333%; }
  .extq__chart.extq__chart--4 th {
    width: 25%; }
  .extq__chart.fourColWithPic th:nth-child(1) {
    width: 20%; }
  .extq__chart.fourColWithPic th:nth-child(2) {
    width: 20%; }
  .extq__chart.fourColWithPic th:nth-child(3) {
    width: 40%; }
  .extq__chart.fourColWithPic th:nth-child(4) {
    width: 20%; }
  .extq__chart.fourColWithExample th:nth-child(1) {
    width: 20%; }
  .extq__chart.fourColWithExample th:nth-child(2) {
    width: 20%; }
  .extq__chart.fourColWithExample th:nth-child(3) {
    width: 30%; }
  .extq__chart.fourColWithExample th:nth-child(4) {
    width: 30%; }
  .extq__chart.threeColWatch th:nth-child(1) {
    width: 18%; }
  .extq__chart.threeColWatch th:nth-child(2) {
    width: 41%; }
  .extq__chart.threeColWatch th:nth-child(3) {
    width: 41%; }
  .extq__chart.fourColWatch th:nth-child(1) {
    width: 19%; }
  .extq__chart.fourColWatch th:nth-child(2) {
    width: 27%; }
  .extq__chart.fourColWatch th:nth-child(3) {
    width: 27%; }
  .extq__chart.fourColWatch th:nth-child(4) {
    width: 27%; }
  .extq__chart td {
    position: relative;
    padding: 1.5rem;
    height: 6rem; }
    .extq__chart td.has-image {
      width: 10rem; }
    .extq__chart td.has-drop {
      padding-right: 2.8rem;
      cursor: pointer; }
    .extq__chart td.has-input {
      padding-left: 1.5rem;
      padding-right: 1.5rem; }
    .extq__chart td.invalid {
      background: rgba(218, 84, 80, 0.2); }
    .extq__chart td.warning {
      background: rgba(255, 220, 25, 0.1); }
    .extq__chart td.has-display-text [ng-bind-html], .extq__chart td.has-display-text [ss-bind-html] {
      overflow-wrap: break-word;
      word-wrap: break-word;
      -ms-word-break: break-all;
      word-break: break-all;
      word-break: break-word; }
  .extq__chart img {
    height: 5rem;
    width: 5rem; }
  .extq__chart .ui-droppable.active {
    background: rgba(0, 171, 230, 0.08); }
  .extq__chart .ui-droppable.hover {
    background: rgba(0, 171, 230, 0.5); }
  .extq__chart .extq__remove {
    height: 1.8rem;
    width: 1.8rem;
    position: absolute;
    top: .6rem;
    right: .6rem;
    background: center center no-repeat;
    border: none;
    background-image: url("data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAA4AAAAOCAMAAAAolt3jAAAAY1BMVEXLycn////LycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnLycnNzMzOzMzPzc3Pzs7o5+fp6Oj29vb///9UqclVAAAAGHRSTlMAABQVFlNUgoOGztDR0tPw8fLz9Pj5+v5sU2mBAAAAfElEQVQYV12P0Q6CMAxF74AJiMjQKZdNGf//lbb1QWKzNDnZ2p0LAFU/xji0FbScn2gVvBP0C1ellYsH6sB3yWQuG0ODlqnsJWdpiT0GvdiLnBc5ItLYiI8fyjxvh8fCl/9VTeB2+Eg1kmok04A7zV/J2SQ1wvV5P3ca4QMlVg8BCKnZIAAAAABJRU5ErkJggg=="); }
  .extq__chart .extq__answer-btn {
    width: 100%;
    height: 100%;
    border: none;
    background: transparent;
    color: transparent; }
    .extq__chart .extq__answer-btn:focus, .extq__chart .extq__answer-btn:hover {
      background: #f5f5f5;
      color: inherit; }
  .extq__chart .extq__input {
    min-height: 5rem; }
    .extq__chart .extq__input.redactor-layer {
      height: 10rem; }
  .extq__chart .extq__teacher-gutter {
    width: 5rem !important; }
  .extq__chart td.extq__teacher-gutter {
    vertical-align: middle; }

.assignment__body .extq__chart {
  width: 100% !important; }

/* Validators */
.extq__validators {
  text-align: right; }
  .extq__validators button {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    opacity: .25;
    font-size: 1.6rem; }
    .extq__validators button.active {
      opacity: 1; }
  .extq__validators .mark-valid:before {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: ""; }
  .extq__validators .mark-valid.active {
    color: #bfd730; }
  .extq__validators .mark-invalid:before {
    font-family: "ss-icons";
    width: auto;
    margin: 0;
    font-style: normal;
    font-weight: normal;
    speak: none;
    display: inline-block;
    text-decoration: inherit;
    line-height: 1em;
    text-align: center;
    font-variant: normal;
    text-transform: none;
    vertical-align: middle;
    position: relative;
    top: -1px;
    text-rendering: optimizeLegibility;
    content: ""; }
  .extq__validators .mark-invalid.active {
    color: #da5450; }

.extq__validator-mark.valid:before {
  font-family: "ss-icons";
  width: auto;
  margin: 0;
  font-style: normal;
  font-weight: normal;
  speak: none;
  display: inline-block;
  text-decoration: inherit;
  line-height: 1em;
  text-align: center;
  font-variant: normal;
  text-transform: none;
  vertical-align: middle;
  position: relative;
  top: -1px;
  text-rendering: optimizeLegibility;
  content: "";
  color: #bfd730; }

.extq__validator-mark.invalid:before {
  font-family: "ss-icons";
  width: auto;
  margin: 0;
  font-style: normal;
  font-weight: normal;
  speak: none;
  display: inline-block;
  text-decoration: inherit;
  line-height: 1em;
  text-align: center;
  font-variant: normal;
  text-transform: none;
  vertical-align: middle;
  position: relative;
  top: -1px;
  text-rendering: optimizeLegibility;
  content: "";
  color: #da5450; }

.extq__validator-mark.unknown:before {
  font-family: "ss-icons";
  width: auto;
  margin: 0;
  font-style: normal;
  font-weight: normal;
  speak: none;
  display: inline-block;
  text-decoration: inherit;
  line-height: 1em;
  text-align: center;
  font-variant: normal;
  text-transform: none;
  vertical-align: middle;
  position: relative;
  top: -1px;
  text-rendering: optimizeLegibility;
  content: ""; }

.help-center-certificate span, .help-center-certificate strong {
  display: block;
  font-weight: normal; }

.help-center-certificate .overlay__body {
  border: 2rem solid #faa21b;
  padding: 4rem;
  text-align: center; }
  .help-center-certificate .overlay__body::before {
    position: absolute;
    top: 3rem;
    right: 3rem;
    bottom: 3rem;
    left: 3rem;
    content: "";
    border: 4px double #faa21b; }

.help-center-certificate .certificate__body {
  margin-bottom: 3rem; }

.help-center-certificate .certificate__name {
  font-size: 3rem; }

.help-center-certificate .certificate__name, .help-center-certificate .certificate__descr {
  color: #faa21b; }

.help-center-certificate .certificate__foot {
  display: flex;
  align-items: center;
  text-align: initial; }

.help-center-certificate .certificate__ribbon {
  font-size: 9rem;
  color: #faa21b;
  text-align: center;
  line-height: 1; }

.help-center-certificate .certificate__signed {
  text-align: right; }
  .help-center-certificate .certificate__signed .signed__title {
    font-size: small;
    font-weight: 300; }

.help-center-certificate .certificate__date, .help-center-certificate .certificate__ribbon, .help-center-certificate .certificate__signed {
  flex: 1;
  justify-content: center; }

.help-center-certificate .logo {
  margin-bottom: 2rem; }

.help-center-certificate + .ngdialog-close {
  top: 2rem;
  right: 4.5rem; }

.help-center .guide-content {
  padding: 0; }
  .help-center .guide-content__child-list {
    margin: 0;
    padding: 0;
    list-style: none;
    padding: 0;
    border-bottom: 1px solid #e1e1e1; }
    .help-center .guide-content__child-list::after {
      clear: both;
      content: "";
      display: table; }
    .help-center .guide-content__child-list > li, .help-center .guide-content__child-list > dd {
      margin: 0; }
    .help-center .guide-content__child-list li {
      position: relative;
      padding: .5rem 0 .5rem 5rem;
      line-height: 3.4rem;
      border-top: 1px solid #e1e1e1; }
      .help-center .guide-content__child-list li > div {
        display: none;
        float: right; }
      .help-center .guide-content__child-list li:hover > div {
        display: inline-block; }
      .help-center .guide-content__child-list li.sortable-chosen {
        border-top: none;
        background-color: #f5f5f5; }
  .help-center .guide-content__child-item {
    display: flex; }
    .help-center .guide-content__child-item > i, .help-center .guide-content__child-item > div {
      flex: 0 0 auto; }
    .help-center .guide-content__child-item > span {
      overflow: hidden;
      text-overflow: ellipsis;
      white-space: nowrap;
      flex: 1 1 auto; }
  .help-center .guide-content__add-buttons > div {
    display: inline-block; }
    .help-center .guide-content__add-buttons > div > button {
      margin-top: 0; }
  .help-center .guide-content section {
    margin: 2rem 0;
    padding: 0; }
  .help-center .guide-content h3 {
    margin-top: 1.2rem; }
  .help-center .guide-content h4 {
    margin-bottom: 2rem; }
  .help-center .guide-content .editable-image.image__preview {
    width: auto;
    min-height: 3rem; }
  .help-center .guide-content .editable-image.image__upload {
    padding: .5rem 0; }

.help-center__element--completed {
  color: #69940c; }

.help-center__element--halfway {
  color: #faa21b; }

.help-center .guide-list__header {
  margin-bottom: 2rem; }
  .help-center .guide-list__header h2 {
    color: #939598;
    font-weight: 400; }
    .help-center .guide-list__header h2 .icon-award, .help-center .guide-list__header h2 .icon-star-empty {
      position: relative;
      top: -.2rem; }

.help-center .guide-list__credit-counter {
  float: right;
  font-size: 1.6rem;
  font-weight: 400;
  color: #939598; }

.help-center .guide-list__section-button {
  float: right;
  margin: -.3rem 0 0 1rem; }

.help-center .guide-list__item-list {
  display: flex;
  flex-wrap: wrap;
  margin: 0 -2rem; }

.help-center .guide-list__item {
  margin: 2rem 0;
  padding: 0 2rem;
  cursor: pointer;
  flex: 0 1 33.33%; }
  @media (max-width: 767px) {
    .help-center .guide-list__item {
      flex: 0 0 100%; } }
  .help-center .guide-list__item h4 {
    color: #faa21b;
    font-weight: 600; }
  .help-center .guide-list__item-summary {
    margin: 0.5rem 0;
    color: darkgrey;
    font-weight: 400;
    font-size: 1.6rem; }

.help-center {
  /* Sticky behavior */ }
  @media (min-width: 768px) {
    .help-center__sidebar-wrapper {
      max-height: calc(100vh - 4rem);
      overflow-y: auto; }
      .help-center__sidebar-wrapper.stuck {
        position: fixed;
        margin: 0;
        padding-top: 1rem;
        box-shadow: 4px 0 4px 0 #e1e1e1;
        margin-top: 2rem; } }
  .help-center .sidebar__details {
    padding: 1.5rem 0; }
  .help-center .sidebar__headline {
    margin-bottom: 2rem; }
  .help-center .guide-sidebar {
    padding-right: 0; }
    .help-center .guide-sidebar__root-link {
      cursor: pointer; }
      .help-center .guide-sidebar__root-link:hover, .help-center .guide-sidebar__root-link:focus {
        color: #faa21b; }
    .help-center .guide-sidebar__tree {
      margin: 1rem 0; }
    .help-center .guide-sidebar__item {
      display: flex;
      width: 100%;
      align-items: center; }
    .help-center .guide-sidebar__item-score {
      font-size: 1.4rem;
      line-height: 1em;
      flex: 0 0 auto;
      white-space: nowrap; }
    .help-center .guide-sidebar--edit-mode .guide-sidebar__item {
      max-width: 100%; }
      .help-center .guide-sidebar--edit-mode .guide-sidebar__item-title {
        overflow: hidden;
        text-overflow: ellipsis;
        white-space: nowrap;
        display: block; }
    .help-center .guide-sidebar .v-tree .guide-sidebar__item-title {
      flex: 1 1 auto;
      font-weight: 600; }
    .help-center .guide-sidebar .v-tree .v-tree .guide-sidebar__item-title {
      font-weight: 500; }
    .help-center .guide-sidebar .v-tree .v-tree .v-tree .guide-sidebar__item-title {
      font-weight: 400; }
    .help-center .guide-sidebar .v-tree .v-tree .v-tree .v-tree .guide-sidebar__item-title {
      font-weight: 300; }
    .help-center .guide-sidebar .v-tree__item-expander {
      display: none; }

.help-center .navbar {
  display: flex;
  flex-wrap: wrap;
  justify-content: center;
  list-style-type: none;
  padding: 0;
  margin-bottom: 0; }
  .help-center .navbar-item {
    margin: 0 1rem 1rem 0; }
    .help-center .navbar-item:last-child {
      margin: 0; }

.help-center__overview-header, .help-center__overview-footer {
  position: relative;
  padding: 4rem 0; }
  @media (min-width: 768px) {
    .help-center__overview-header, .help-center__overview-footer {
      padding: 8rem 0; }
      .help-center__overview-header::before, .help-center__overview-footer::before {
        position: absolute;
        top: 0;
        left: 0;
        content: "";
        height: 100%;
        width: 100%;
        z-index: -1; } }
  .help-center__overview-header h1, .help-center__overview-footer h1 {
    font-size: 3.5rem;
    line-height: 1.1;
    font-weight: 200;
    text-align: center;
    margin: 0 auto 2rem; }

@media (min-width: 768px) {
  .help-center__overview-header {
    margin-top: -2.5rem; }
    .help-center__overview-header::before {
      background: url("../img/home-hero-help.jpg") 100% 100% no-repeat;
      background-size: cover; } }

@media (max-width: 767px) {
  .help-center__overview-footer {
    padding-top: 1rem; } }

@media (min-width: 768px) {
  .help-center__overview-footer:before {
    background: url("../img/home-hero-help-2.jpg") 100% 20% no-repeat;
    background-size: cover; } }

.help-center .search-bar {
  margin-bottom: 2.5rem; }

.help-center .help-center__search-list {
  margin: 0;
  padding: 0;
  list-style: none; }
  .help-center .help-center__search-list::after {
    clear: both;
    content: "";
    display: table; }
  .help-center .help-center__search-list > li, .help-center .help-center__search-list > dd {
    margin: 0; }
  .help-center .help-center__search-list .hr {
    margin: 1rem 0; }

.help-center .help-center__search-list-item:first-child {
  margin-top: 2rem; }

.help-center .help-center__item-location {
  font-size: 1.5rem;
  color: #939598; }

.help-center .help-center__item-name span {
  color: #939598;
  margin-right: .5rem; }

.help-center .help-center__item-name h3, .help-center .help-center__item-name h4 {
  display: inline;
  color: #faa21b;
  font-weight: 400; }

.help-center .help-center__poster-container {
  height: 100px;
  margin: 1rem 0; }
  .help-center .help-center__poster-container img {
    max-height: 100%;
    max-width: 100%; }

.multitool__header {
  display: -webkit-box;
  display: -moz-box;
  display: box;
  display: -webkit-flex;
  display: -moz-flex;
  display: -ms-flexbox;
  display: flex;
  -webkit-box-align: center;
  -moz-box-align: center;
  box-align: center;
  -webkit-align-items: center;
  -moz-align-items: center;
  -ms-align-items: center;
  -o-align-items: center;
  align-items: center;
  -ms-flex-align: center;
  margin-bottom: 2rem; }
  .multitool__header.header--hr {
    border-bottom: 1px solid #e1e1e1;
    padding-bottom: 1.2rem; }
  .multitool__header.stuck {
    background-color: white; }

.multitool__headline {
  -webkit-box-flex: 1;
  -moz-box-flex: 1;
  box-flex: 1;
  -webkit-flex: 1;
  -moz-flex: 1;
  -ms-flex: 1;
  flex: 1;
  margin-right: 24px; }
  .multitool__headline h2 {
    font-weight: 300;
    font-size: 2.4rem;
    line-height: 2.7rem; }

.multitool__body {
  position: relative; }

.multitool__annotation-help {
  font-style: italic;
  margin-bottom: 2rem;
  background: rgba(28, 28, 28, 0.05);
  padding: 2rem; }

.multitool__content {
  -webkit-transition: padding 0.15s ease-in-out;
  -moz-transition: padding 0.15s ease-in-out;
  transition: padding 0.15s ease-in-out;
  position: relative;
  padding-right: 2.5rem; }
  .multitool__content.numbering-on {
    padding-left: 2.5rem;
    padding-right: 0rem; }
    .multitool__content.numbering-on .para {
      opacity: 1; }
  .multitool__content.user-select-disabled {
    -webkit-user-select: none !important;
    -moz-user-select: none !important;
    -ms-user-select: none !important;
    user-select: none !important; }
  .multitool__content h1, .multitool__content h2, .multitool__content h3, .multitool__content h4, .multitool__content h5, .multitool__content h6 {
    font-size: inherit;
    line-height: inherit;
    font-weight: bold; }

.multitool__meta {
  margin: 0;
  padding: 0;
  list-style: none;
  font-size: 1.3rem;
  line-height: 1.625;
  margin: -1.5rem 0 2rem;
  text-align: right;
  color: #939598; }
  .multitool__meta::after {
    clear: both;
    content: "";
    display: table; }
  .multitool__meta > li, .multitool__meta > dd {
    margin: 0; }
  .multitool__meta li {
    display: inline-block; }
  .multitool__meta li + li:before {
    content: '|';
    margin: 0 .5rem; }

.multitool .para {
  -webkit-transition: opacity 0.1s ease-in-out;
  -moz-transition: opacity 0.1s ease-in-out;
  transition: opacity 0.1s ease-in-out;
  position: absolute;
  left: 0;
  opacity: 0; }

.multitool .word {
  text-indent: 0;
  display: inline-block; }
  .multitool .word.inline-tweak {
    display: inline; }

.multitool .selected-word {
  -webkit-transition: none;
  -moz-transition: none;
  transition: none;
  background-color: #b4d6ff; }

.multitool .is-annotated {
  -webkit-transition: background 0.15s ease-in-out;
  -moz-transition: background 0.15s ease-in-out;
  transition: background 0.15s ease-in-out;
  position: relative;
  background-color: rgba(255, 220, 25, 0.5);
  cursor: pointer; }
  .multitool .is-annotated.hovered-word {
    background-color: rgba(255, 220, 25, 0.8); }
  .multitool .is-annotated.has-note:before {
    position: absolute;
    right: 0;
    bottom: 0;
    left: 0;
    height: .3rem;
    content: '';
    background-color: #ffdc19; }
  .multitool .is-annotated.color-1 {
    background-color: rgba(255, 220, 25, 0.5); }
    .multitool .is-annotated.color-1.hovered-word {
      background-color: rgba(255, 220, 25, 0.8); }
    .multitool .is-annotated.color-1.has-note:before {
      background-color: #ffdc19; }
  .multitool .is-annotated.color-2 {
    background-color: rgba(154, 72, 142, 0.5); }
    .multitool .is-annotated.color-2.hovered-word {
      background-color: rgba(154, 72, 142, 0.8); }
    .multitool .is-annotated.color-2.has-note:before {
      background-color: #9a488e; }
  .multitool .is-annotated.color-3 {
    background-color: rgba(250, 162, 27, 0.5); }
    .multitool .is-annotated.color-3.hovered-word {
      background-color: rgba(250, 162, 27, 0.8); }
    .multitool .is-annotated.color-3.has-note:before {
      background-color: #faa21b; }
  .multitool .is-annotated.color-4 {
    background-color: rgba(0, 171, 230, 0.5); }
    .multitool .is-annotated.color-4.hovered-word {
      background-color: rgba(0, 171, 230, 0.8); }
    .multitool .is-annotated.color-4.has-note:before {
      background-color: #00abe6; }
  .multitool .is-annotated.color-5 {
    background-color: rgba(218, 84, 80, 0.5); }
    .multitool .is-annotated.color-5.hovered-word {
      background-color: rgba(218, 84, 80, 0.8); }
    .multitool .is-annotated.color-5.has-note:before {
      background-color: #da5450; }
  .multitool .is-annotated.color-6 {
    background-color: rgba(146, 175, 43, 0.5); }
    .multitool .is-annotated.color-6.hovered-word {
      background-color: rgba(146, 175, 43, 0.8); }
    .multitool .is-annotated.color-6.has-note:before {
      background-color: #92af2b; }

.multitool .phrase.isHighlighted {
  background-color: rgba(255, 220, 25, 0.4) !important; }

.multitool .phrase.currentPhrase {
  background-color: #ffdc19 !important; }

.multitool .inline-state-nav {
  margin: 0; }

.multitool .gdoc {
  padding: 3rem 2.5rem;
  background: #f5f5f5;
  border-radius: 5px;
  margin-bottom: 2.5rem; }
  .multitool .gdoc:last-child {
    padding-bottom: 3rem; }
  .multitool .gdoc__footer {
    font-size: 1.5rem;
    line-height: 1.625; }
  .multitool .gdoc .text {
    padding: 0; }
  .multitool .gdoc .guard {
    background: #fff;
    border-radius: 6px;
    padding: 2rem;
    border: 1px solid rgba(1, 1, 1, 0.1); }
    .multitool .gdoc .guard h3:first-child {
      padding-top: 0; }

.picadiff__header {
  display: block; }
  .picadiff__header::after {
    clear: both;
    content: "";
    display: table; }
  .picadiff__header .headline {
    padding: 1.5rem;
    background-color: #f5f5f5;
    border-radius: 4px; }

.picadiff__body {
  display: block; }
  .picadiff__body::after {
    clear: both;
    content: "";
    display: table; }
  .picadiff__body .picadiff-content {
    display: block;
    margin-bottom: 3rem; }
    .picadiff__body .picadiff-content::after {
      clear: both;
      content: "";
      display: table; }
    .picadiff__body .picadiff-content .left, .picadiff__body .picadiff-content .right {
      padding-top: 3rem; }
    @media (max-width: 767px) {
      .picadiff__body .picadiff-content .left {
        padding-bottom: 3rem;
        border-bottom: 1px solid #e1e1e1; } }

.picadiff__foot {
  display: block;
  padding-top: 3rem;
  border-top: 1px solid #e1e1e1; }
  .picadiff__foot::after {
    clear: both;
    content: "";
    display: table; }

.picadiff .equal {
  background-color: rgba(255, 220, 25, 0.5); }

.ss-carousel {
  position: relative; }
  .ss-carousel .flickity-prev-next-button {
    display: none;
    background: none; }
    @media (min-width: 850px) {
      .ss-carousel .flickity-prev-next-button {
        display: block; } }
    .ss-carousel .flickity-prev-next-button .arrow {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out; }
  .ss-carousel .flickity-page-dots .dot {
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out; }
  .ss-carousel.library-featured .flickity-page-dots {
    position: absolute;
    top: auto;
    right: auto;
    bottom: 2rem;
    left: auto; }
    .ss-carousel.library-featured .flickity-page-dots .dot {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      background: rgba(255, 255, 255, 0.7); }
      .ss-carousel.library-featured .flickity-page-dots .dot.is-selected {
        background: #f77e0d; }
  .ss-carousel.library-featured .slideshow__wrapper {
    width: 100%;
    min-height: 40rem;
    background-size: cover;
    background-position: center; }
    .ss-carousel.library-featured .slideshow__wrapper:before {
      position: absolute;
      top: 0;
      right: 0;
      bottom: 0;
      left: 0;
      background: -webkit-linear-gradient(90deg, rgba(28, 28, 28, 0.9) 10%, rgba(28, 28, 28, 0) 60%, rgba(28, 28, 28, 0) 100%);
      background: linear-gradient(90deg, rgba(28, 28, 28, 0.9) 10%, rgba(28, 28, 28, 0) 60%, rgba(28, 28, 28, 0) 100%);
      content: '';
      z-index: 2; }
    @media (min-width: 850px) {
      .ss-carousel.library-featured .slideshow__wrapper {
        height: 400px; } }
    .ss-carousel.library-featured .slideshow__wrapper .container {
      height: 100%; }
      @media screen and (min-width: 850px) and (max-width: 1200px) {
        .ss-carousel.library-featured .slideshow__wrapper .container {
          padding-right: 5rem;
          padding-left: 5rem; } }
  .ss-carousel.library-featured .slideshow__body {
    position: relative;
    float: left;
    padding: 3rem 0;
    z-index: 3; }
    @media (min-width: 850px) {
      .ss-carousel.library-featured .slideshow__body {
        -webkit-transform: translateY(-50%);
        -moz-transform: translateY(-50%);
        -ms-transform: translateY(-50%);
        -o-transform: translateY(-50%);
        transform: translateY(-50%);
        position: relative;
        top: 50%;
        width: 50%;
        padding: 3rem 0; } }
    .ss-carousel.library-featured .slideshow__body .body__name {
      font-size: 4.8rem;
      line-height: 1;
      color: #ffffff;
      font-weight: 100;
      margin-bottom: .5rem; }
    .ss-carousel.library-featured .slideshow__body .body__byline {
      font-size: 1.5rem;
      line-height: 1.2;
      display: block;
      color: rgba(255, 255, 255, 0.7); }
      .ss-carousel.library-featured .slideshow__body .body__byline:after {
        height: 2px;
        width: 80px;
        display: block;
        margin: 2rem 0;
        background: rgba(255, 255, 255, 0.25);
        content: ''; }
      .ss-carousel.library-featured .slideshow__body .body__byline strong {
        color: #ffffff;
        font-weight: 500; }
    .ss-carousel.library-featured .slideshow__body .body__desc {
      font-size: 1.8rem;
      line-height: 1.5;
      color: #ffffff; }
  .ss-carousel.library-featured .slideshow__image {
    display: none; }
    @media (min-width: 850px) {
      .ss-carousel.library-featured .slideshow__image {
        -webkit-transform: translateY(-50%);
        -moz-transform: translateY(-50%);
        -ms-transform: translateY(-50%);
        -o-transform: translateY(-50%);
        transform: translateY(-50%);
        position: relative;
        top: 50%;
        width: 45%;
        display: inherit;
        float: right;
        z-index: 3; } }
  .ss-carousel.library-featured .slideshow__bgvideo {
    display: none;
    position: absolute;
    width: 100%;
    z-index: 1; }
    @media (min-width: 1150px) {
      .ss-carousel.library-featured .slideshow__bgvideo {
        display: block; } }
  @media screen and (max-width: 1200px) {
    .ss-carousel.library-slideshow {
      margin-left: 3rem;
      margin-right: 3rem; } }
  .ss-carousel.library-slideshow .flickity-viewport {
    outline: none !important; }
  .ss-carousel.library-slideshow .flickity-page-dots {
    margin: 0;
    padding: 0;
    list-style: none;
    -webkit-transition: opacity 0.3s;
    -moz-transition: opacity 0.3s;
    transition: opacity 0.3s;
    font-size: 0;
    line-height: 0;
    position: absolute;
    top: -3.5rem;
    right: 0;
    bottom: auto;
    left: auto;
    width: auto;
    text-align: center; }
    .ss-carousel.library-slideshow .flickity-page-dots::after {
      clear: both;
      content: "";
      display: table; }
    .ss-carousel.library-slideshow .flickity-page-dots > li, .ss-carousel.library-slideshow .flickity-page-dots > dd {
      margin: 0; }
    @media (max-width: 767px) {
      .ss-carousel.library-slideshow .flickity-page-dots {
        display: none !important; } }
    .ss-carousel.library-slideshow .flickity-page-dots .dot {
      margin-right: 0.5rem;
      margin-left: 0.5rem;
      height: 8px;
      width: 8px;
      display: inline-block;
      background: rgba(28, 28, 28, 0.4);
      border-radius: 50%; }
      .ss-carousel.library-slideshow .flickity-page-dots .dot:first-child {
        margin-left: 0; }
      .ss-carousel.library-slideshow .flickity-page-dots .dot:last-child {
        margin-right: 0; }
      .ss-carousel.library-slideshow .flickity-page-dots .dot.is-selected {
        background: #f77e0d; }
  .ss-carousel.library-slideshow .flickity-prev-next-button {
    -webkit-transform: none;
    -moz-transform: none;
    -ms-transform: none;
    -o-transform: none;
    transform: none;
    top: 0;
    padding-bottom: 17.8%; }
    .ss-carousel.library-slideshow .flickity-prev-next-button.previous {
      left: -44px; }
    .ss-carousel.library-slideshow .flickity-prev-next-button.next {
      right: -44px; }
    .ss-carousel.library-slideshow .flickity-prev-next-button .arrow {
      -webkit-transition: fill 0.15s ease-in-out;
      -moz-transition: fill 0.15s ease-in-out;
      transition: fill 0.15s ease-in-out;
      fill: #939598; }
    .ss-carousel.library-slideshow .flickity-prev-next-button:hover .arrow {
      fill: #4b4a4b; }
  .ss-carousel.library-slideshow .carousel__content {
    margin-right: -0.5rem;
    margin-left: -0.5rem; }
  .ss-carousel.library-slideshow .carousel__slide {
    width: 75%; }
    @media (min-width: 768px) {
      .ss-carousel.library-slideshow .carousel__slide {
        width: calc(50% - .75rem);
        margin-right: 1rem; } }
    @media (min-width: 850px) {
      .ss-carousel.library-slideshow .carousel__slide {
        width: calc(33.33% - .75rem); } }
    .ss-carousel.library-slideshow .carousel__slide a:focus {
      outline: none !important; }
  .ss-carousel.library-slideshow .carousel__preview {
    -webkit-transition: max-height 0.5s;
    -moz-transition: max-height 0.5s;
    transition: max-height 0.5s;
    display: block;
    clear: both;
    display: table;
    position: relative;
    margin-left: -12px;
    margin-right: -12px;
    width: 100%;
    margin-left: 0;
    margin-right: 0;
    display: block;
    width: auto;
    margin: 2rem 0 0;
    overflow: hidden;
    box-shadow: 0 0 5px 0 rgba(28, 28, 28, 0.3);
    position: relative; }
    .ss-carousel.library-slideshow .carousel__preview::after {
      clear: both;
      content: "";
      display: table; }
    .ss-carousel.library-slideshow .carousel__preview > * {
      float: left;
      display: block;
      margin-right: 3.84615%;
      width: 100%;
      width: 100%;
      padding-left: 12px;
      padding-right: 12px;
      margin-right: 0; }
      .ss-carousel.library-slideshow .carousel__preview > *:last-child {
        margin-right: 0; }
      @media print {
        .ss-carousel.library-slideshow .carousel__preview > * {
          float: left !important; } }
    @media (max-width: 767px) {
      .ss-carousel.library-slideshow .carousel__preview {
        display: none; } }
    .ss-carousel.library-slideshow .carousel__preview.ng-enter, .ss-carousel.library-slideshow .carousel__preview.ng-leave.ng-leave-active {
      max-height: 0; }
    .ss-carousel.library-slideshow .carousel__preview.ng-leave, .ss-carousel.library-slideshow .carousel__preview.ng-enter.ng-enter-active {
      max-height: 320px; }
    .ss-carousel.library-slideshow .carousel__preview.ng-enter ss-video {
      display: none; }
    .ss-carousel.library-slideshow .carousel__preview * {
      -webkit-transition: opacity 0.15s;
      -moz-transition: opacity 0.15s;
      transition: opacity 0.15s;
      opacity: 1; }
    .ss-carousel.library-slideshow .carousel__preview.ng-animate * {
      opacity: 0; }
    .ss-carousel.library-slideshow .carousel__preview .preview__poster, .ss-carousel.library-slideshow .carousel__preview .preview__body {
      display: table-cell;
      width: 50%;
      width: 50%;
      padding-left: 12px;
      padding-right: 12px;
      margin-right: 0;
      vertical-align: top; }
      @media print {
        .ss-carousel.library-slideshow .carousel__preview .preview__poster, .ss-carousel.library-slideshow .carousel__preview .preview__body {
          float: left !important; } }
      .ss-carousel.library-slideshow .carousel__preview .preview__poster:first-child, .ss-carousel.library-slideshow .carousel__preview .preview__body:first-child {
        padding-left: 0; }
      .ss-carousel.library-slideshow .carousel__preview .preview__poster:last-child, .ss-carousel.library-slideshow .carousel__preview .preview__body:last-child {
        padding-right: 0; }
    .ss-carousel.library-slideshow .carousel__preview .preview__poster {
      line-height: 0;
      position: relative; }
      .ss-carousel.library-slideshow .carousel__preview .preview__poster img {
        display: block;
        width: 100%; }
      .ss-carousel.library-slideshow .carousel__preview .preview__poster ss-video {
        position: absolute;
        top: 0;
        right: 12px;
        bottom: 0;
        left: 0; }
      .ss-carousel.library-slideshow .carousel__preview .preview__poster.has-video img {
        visibility: hidden; }
    .ss-carousel.library-slideshow .carousel__preview .preview__body {
      padding-top: 1.5rem;
      padding-bottom: 1.5rem;
      line-height: 2rem;
      padding-right: 4rem !important; }
      .ss-carousel.library-slideshow .carousel__preview .preview__body h3 {
        font-weight: 400;
        font-size: 2.6rem;
        line-height: 3.1rem; }
    .ss-carousel.library-slideshow .carousel__preview .preview__close {
      background: none;
      border: none;
      margin: 0;
      padding: 0;
      font-size: inherit;
      line-height: inherit;
      position: absolute;
      top: 1.5rem;
      right: 1.5rem;
      font-size: 0;
      line-height: 0; }
      .ss-carousel.library-slideshow .carousel__preview .preview__close:before {
        -webkit-transition: all 0.15s ease-in-out;
        -moz-transition: all 0.15s ease-in-out;
        transition: all 0.15s ease-in-out;
        font-size: 1.8rem;
        line-height: 1em;
        font-family: "ss-icons";
        width: auto;
        margin: 0;
        font-style: normal;
        font-weight: normal;
        speak: none;
        display: inline-block;
        text-decoration: inherit;
        line-height: 1em;
        text-align: center;
        font-variant: normal;
        text-transform: none;
        vertical-align: middle;
        position: relative;
        top: -1px;
        text-rendering: optimizeLegibility;
        content: ""; }
    .ss-carousel.library-slideshow .carousel__preview .preview__view-btn {
      font-size: 1.6rem;
      line-height: 3.4rem;
      background-color: #fdb913;
      background-image: -webkit-linear-gradient(#fdb913, #faa21b);
      background-image: linear-gradient(#fdb913, #faa21b);
      display: inline-block;
      height: 3.4rem;
      padding: 0 23px;
      color: #ffffff !important;
      text-transform: none;
      border: none;
      vertical-align: middle;
      font-weight: 400;
      border-radius: .5rem;
      position: relative;
      /* Colors */
      /* Size */
      /* Icon */
      /* Mouse Actions */
      padding-right: 15px;
      padding-left: 15px;
      font-size: 1.3rem;
      line-height: 30px;
      height: 30px;
      background: transparent;
      border: 1px solid rgba(147, 149, 152, 0.5);
      color: #939598 !important;
      position: absolute;
      top: auto;
      right: 1.5rem;
      bottom: 1.5rem;
      left: auto; }
      .ss-carousel.library-slideshow .carousel__preview .preview__view-btn[disabled] {
        opacity: .5; }
      .ss-carousel.library-slideshow .carousel__preview .preview__view-btn.loading {
        opacity: 1;
        color: rgba(255, 255, 255, 0) !important; }
      .ss-carousel.library-slideshow .carousel__preview .preview__view-btn[class*='icon']:before {
        margin-right: .5rem; }
      .ss-carousel.library-slideshow .carousel__preview .preview__view-btn:active {
        top: 1px; }
      .ss-carousel.library-slideshow .carousel__preview .preview__view-btn:active {
        top: auto;
        bottom: 1.4rem; }
  .ss-carousel.library-slideshow .slideshow__image {
    opacity: 1;
    padding-bottom: 54%;
    background: center center no-repeat;
    background-size: cover; }
    .ss-carousel.library-slideshow .slideshow__image img {
      display: none; }
  .ss-carousel.library-slideshow .slideshow__content {
    position: absolute;
    top: 0;
    right: 0;
    bottom: 0;
    left: 0;
    -webkit-transition: opacity 0.15s;
    -moz-transition: opacity 0.15s;
    transition: opacity 0.15s;
    opacity: 0;
    background: rgba(28, 28, 28, 0.8);
    z-index: 2; }
    .ss-carousel.library-slideshow .slideshow__content:hover, .ss-carousel.library-slideshow .slideshow__content.hover {
      opacity: 1; }
  .ss-carousel.library-slideshow .slideshow__body {
    position: absolute;
    top: 0;
    right: 0;
    bottom: 0;
    left: 0;
    display: block; }
    .ss-carousel.library-slideshow .slideshow__body.previewable {
      bottom: 3rem; }
    .ss-carousel.library-slideshow .slideshow__body .body__inner {
      position: absolute;
      right: 2rem;
      bottom: 2rem;
      left: 2rem; }
    .ss-carousel.library-slideshow .slideshow__body .body__name {
      font-size: 1.9rem;
      line-height: 1.2;
      color: #f77e0d;
      margin-bottom: .25rem;
      font-weight: 400; }
    .ss-carousel.library-slideshow .slideshow__body .body__byline {
      font-size: 1.5rem;
      line-height: 1.2;
      display: block;
      color: rgba(255, 255, 255, 0.7); }
      .ss-carousel.library-slideshow .slideshow__body .body__byline strong {
        color: #ffffff;
        font-weight: 500; }
  .ss-carousel.library-slideshow .slideshow__expand {
    background: none;
    border: none;
    margin: 0;
    padding: 0;
    font-size: inherit;
    line-height: inherit;
    -webkit-transition: all 0.15s ease-in-out;
    -moz-transition: all 0.15s ease-in-out;
    transition: all 0.15s ease-in-out;
    position: absolute;
    top: calc(100% - 3rem);
    right: 0;
    bottom: 0;
    left: 0;
    width: 100%;
    border-top: 1px solid rgba(255, 255, 255, 0.2);
    background: transparent; }
    @media (max-width: 767px) {
      .ss-carousel.library-slideshow .slideshow__expand {
        display: none; } }
    .ss-carousel.library-slideshow .slideshow__expand:before {
      position: absolute;
      top: 0;
      right: 0;
      bottom: 0;
      left: 0;
      font-family: "ss-icons";
      width: auto;
      margin: 0;
      font-style: normal;
      font-weight: normal;
      speak: none;
      display: inline-block;
      text-decoration: inherit;
      line-height: 1em;
      text-align: center;
      font-variant: normal;
      text-transform: none;
      vertical-align: middle;
      position: relative;
      top: -1px;
      text-rendering: optimizeLegibility;
      content: "";
      color: #ffffff;
      opacity: .7; }
    .ss-carousel.library-slideshow .slideshow__expand:hover, .ss-carousel.library-slideshow .slideshow__expand:focus {
      outline: none !important;
      background-color: rgba(250, 162, 27, 0.7); }
  .ss-carousel.library-slideshow .slideshow__lower {
    display: block;
    margin-top: .75rem;
    padding-right: 1rem; }
    .ss-carousel.library-slideshow .slideshow__lower .lower__name {
      -webkit-transition: all 0.15s ease-in-out;
      -moz-transition: all 0.15s ease-in-out;
      transition: all 0.15s ease-in-out;
      font-size: 1.8rem;
      line-height: 1.2;
      color: #faa21b;
      font-weight: 500; }
    .ss-carousel.library-slideshow .slideshow__lower .lower__byline {
      font-size: 1.6rem;
      line-height: 1.4;
      display: block;
      margin-top: .25rem;
      color: #4b4a4b;
      opacity: .7; }
    .ss-carousel.library-slideshow .slideshow__lower .body__byline {
      opacity: .7; }
  .ss-carousel--masthead, .ss-carousel--masthead.library-slideshow {
    margin-bottom: 2.5rem; }
    .ss-carousel--masthead .slideshow__body .body__subhead, .ss-carousel--masthead.library-slideshow .slideshow__body .body__subhead {
      font-size: 1.5rem;
      line-height: 1.625;
      display: block;
      margin-bottom: .5rem;
      color: #faa21b;
      font-weight: 400; }
    .ss-carousel--masthead .flickity-prev-next-button .arrow, .ss-carousel--masthead.library-slideshow .flickity-prev-next-button .arrow {
      fill: rgba(255, 255, 255, 0.5); }
    .ss-carousel--masthead .flickity-prev-next-button:hover .arrow, .ss-carousel--masthead.library-slideshow .flickity-prev-next-button:hover .arrow {
      fill: #ffffff; }
    .ss-carousel--masthead .flickity-page-dots .dot, .ss-carousel--masthead.library-slideshow .flickity-page-dots .dot {
      background: #ffffff; }
  .ss-carousel--show-overlay.library-slideshow .slideshow__body .body__inner {
    left: 1rem;
    right: 1rem;
    bottom: 1rem; }
  .ss-carousel--show-overlay.library-slideshow .slideshow__content {
    background: -webkit-linear-gradient(rgba(28, 28, 28, 0) 0%, rgba(28, 28, 28, 0) 15%, #1c1c1c);
    background: linear-gradient(rgba(28, 28, 28, 0) 0%, rgba(28, 28, 28, 0) 15%, #1c1c1c);
    opacity: 1; }

.bar-separated-list {
  list-style: none;
  padding: 0; }
  .bar-separated-list li {
    display: inline; }
    .bar-separated-list li:after {
      content: ' | '; }
    .bar-separated-list li:last-child:after {
      content: ''; }

.comma:after {
  content: ', '; }

.comma:last-child:after {
  content: ''; }

.comma-separated-list {
  list-style: none;
  padding: 0; }
  .comma-separated-list li {
    display: inline; }
    .comma-separated-list li:after {
      content: ', '; }
    .comma-separated-list li:last-child:after {
      content: ''; }

.inline-list {
  display: inline; }

.filter-greyscale {
  -webkit-filter: grayscale(90%);
  filter: grayscale(90%); }

.library-search-results.ng-enter {
  -webkit-animation-name: zoomIn;
  -moz-animation-name: zoomIn;
  animation-name: zoomIn;
  -webkit-animation-delay: 0;
  -moz-animation-delay: 0;
  animation-delay: 0;
  -webkit-animation-duration: 0.3s;
  -moz-animation-duration: 0.3s;
  animation-duration: 0.3s;
  -webkit-animation-fill-mode: both;
  -moz-animation-fill-mode: both;
  animation-fill-mode: both; }

.library-search-results.ng-leave {
  -webkit-animation-name: zoomOut;
  -moz-animation-name: zoomOut;
  animation-name: zoomOut;
  -webkit-animation-delay: 0;
  -moz-animation-delay: 0;
  animation-delay: 0;
  -webkit-animation-duration: 0.3s;
  -moz-animation-duration: 0.3s;
  animation-duration: 0.3s;
  -webkit-animation-fill-mode: both;
  -moz-animation-fill-mode: both;
  animation-fill-mode: both; }

.docLink > span {
  font-size: 200%;
  display: inline;
  line-height: 2.5rem; }

.docLink > div {
  display: inline-block;
  position: relative;
  top: 8px;
  left: 6px; }
  .docLink > div > span {
    text-transform: uppercase;
    font-size: 75%; }

.login-text {
  display: none;
  position: absolute;
  right: 12px;
  bottom: 16px;
  top: 40px; }
  @media (min-width: 768px) {
    .login-text {
      display: block; } }

.signin-container {
  -webkit-animation-name: slideInDown;
  -moz-animation-name: slideInDown;
  animation-name: slideInDown;
  -webkit-animation-delay: 0;
  -moz-animation-delay: 0;
  animation-delay: 0;
  -webkit-animation-duration: 0.8s;
  -moz-animation-duration: 0.8s;
  animation-duration: 0.8s;
  -webkit-animation-fill-mode: both;
  -moz-animation-fill-mode: both;
  animation-fill-mode: both;
  border-bottom-left-radius: 10px;
  border-bottom-right-radius: 10px;
  height: 540px;
  margin-top: -1.5rem; }

.signin-content {
  background-color: rgba(128, 175, 47, 0.8);
  padding: 12px;
  margin-top: 16px; }
  .signin-content input {
    font-size: 90%;
    text-align: center; }
    .signin-content input[disabled] {
      background-color: #e1e1e1;
      border: solid 2px #e1e1e1; }
  .signin-content .btn {
    margin-top: 16px; }
  .signin-content .msg {
    color: #ffffff;
    font-weight: 400;
    text-transform: uppercase; }
  .signin-content label {
    color: #ffffff; }
  .signin-content div.ng-enter {
    transition: 0.2s ease-out opacity;
    opacity: 0; }
  .signin-content div.ng-enter.ng-enter-active {
    opacity: 1; }

.progress-bar {
  background-color: #f2f2f2;
  border-radius: 3px;
  border: 1px solid gainsboro;
  box-shadow: inset 0 0 3px 0 rgba(115, 115, 115, 0.15);
  margin: 0 auto;
  width: 100%; }
  .progress-bar > span.meter {
    background-color: #477DCA;
    background-repeat: repeat-x;
    background-size: 40px 40px;
    border: 1px solid #2c5999;
    border-bottom-right-radius: 0;
    border-radius: 2px;
    border-top-right-radius: 0;
    box-sizing: border-box;
    display: block;
    height: 100%;
    width: 60%; }
  .progress-bar p {
    color: #ffffff;
    line-height: 1.5em;
    height: 1.5em;
    margin: 0;
    padding: 0.1em 0.5em;
    text-shadow: 0 0 1px black;
    overflow: hidden; }

.text-center .btn + .btn {
  margin-left: 1em; }

.zoom-in {
  -webkit-animation-name: zoomIn;
  -moz-animation-name: zoomIn;
  animation-name: zoomIn;
  -webkit-animation-delay: 0;
  -moz-animation-delay: 0;
  animation-delay: 0;
  -webkit-animation-duration: 0.3s;
  -moz-animation-duration: 0.3s;
  animation-duration: 0.3s;
  -webkit-animation-fill-mode: both;
  -moz-animation-fill-mode: both;
  animation-fill-mode: both; }

.google-doc-template {
  display: none; }

.google-doc-title {
  display: none; }

@media (min-width: 768px) {
  .sync-blasts .home-masthead {
    background-image: url("../img/home-hero-syncblasts.jpg"); } }

.v-tree {
  margin: 0;
  padding: 0;
  list-style: none;
  border-top: 1px solid #e1e1e1; }
  .v-tree::after {
    clear: both;
    content: "";
    display: table; }
  .v-tree > li, .v-tree > dd {
    margin: 0; }
  .v-tree .v-tree {
    padding-left: 2rem;
    border: none; }
  .v-tree .v-tree__item {
    /* open/close effects */ }
    .v-tree .v-tree__item .v-tree__item-header {
      padding: 1rem .7rem;
      cursor: pointer;
      display: flex;
      align-items: center;
      border-bottom: 1px solid #e1e1e1; }
      .v-tree .v-tree__item .v-tree__item-header .v-tree__item-expander::before {
        flex: 0 0 auto;
        height: 2rem;
        width: 2rem;
        background: #f77e0d;
        border-radius: 50%;
        line-height: 2rem;
        color: #ffffff;
        margin: 0 .7rem 0 0;
        padding-left: .15em;
        padding-top: .05em; }
      .v-tree .v-tree__item .v-tree__item-header .v-tree__item-title {
        flex: 1 1 auto;
        padding: 0 .7rem 0 0; }
    .v-tree .v-tree__item.v-tree__item--selected > .v-tree__item-header {
      background-color: #F9F9F9;
      color: #faa21b; }
    .v-tree .v-tree__item.v-tree__item--inactive {
      filter: grayscale(100%);
      font-style: italic; }
    .v-tree .v-tree__item.v-tree__item--expanded > .v-tree__item-header .v-tree__item-expander::before {
      -webkit-transform: rotate(90deg);
      -moz-transform: rotate(90deg);
      -ms-transform: rotate(90deg);
      -o-transform: rotate(90deg);
      transform: rotate(90deg); }
    .v-tree .v-tree__item .subitems-enter-active {
      transition: transform .3s ease;
      transform-origin: top;
      overflow: hidden; }
    .v-tree .v-tree__item .subitems-enter-to, .v-tree .v-tree__item .subitems-leave {
      transform: scaleY(1); }
    .v-tree .v-tree__item .subitems-enter, .v-tree .v-tree__item .subitems-leave-to {
      transform: scaleY(0); }

@media print {
  /* Print Reset */
  *,
  *:before,
  *:after {
    background: transparent !important;
    color: #1c1c1c !important;
    box-shadow: none !important;
    text-shadow: none !important;
    float: none !important; }
  html, body {
    height: auto; }
  a,
  a:visited {
    text-decoration: underline; }
  abbr[title]:after {
    content: " (" attr(title) ")"; }
  pre,
  blockquote {
    border: 1px solid #939598;
    page-break-inside: avoid; }
  thead {
    display: table-header-group; }
  tr,
  img {
    page-break-inside: avoid; }
  img {
    max-width: 100% !important; }
  p,
  h2,
  h3 {
    orphans: 3;
    widows: 3; }
  h2,
  h3 {
    page-break-after: avoid; }
  print-page-break {
    display: block;
    page-break-after: always; } }

/* Themes */
#theme-usa .accordion v-pane {
  border-color: #aeb0b5; }
  #theme-usa .accordion v-pane.compare {
    border-color: #0071bc; }
    #theme-usa .accordion v-pane.compare + :not(.compare) {
      border-color: #0071bc; }
    #theme-usa .accordion v-pane.compare__divider {
      border-color: #0071bc !important; }

#theme-usa .accordion v-pane-header .section__type icon {
  color: #0071bc; }

#theme-usa .accordion v-pane-header:hover::after, #theme-usa .accordion v-pane-header:focus::after {
  background: #112e51; }

#theme-usa .accordion v-pane-header:hover .section__name, #theme-usa .accordion v-pane-header:focus .section__name {
  color: #0071bc; }

#theme-usa .accordion v-pane-header:hover .section__type icon, #theme-usa .accordion v-pane-header:focus .section__type icon {
  color: #112e51; }

#theme-usa .accordion v-pane-header::after {
  background: #0071bc; }

#theme-usa .assignment-wrap {
  border-color: #5b616b; }
  #theme-usa .assignment-wrap.active {
    border-color: #0071bc; }
  #theme-usa .assignment-wrap .wrap__toggle {
    background: #5b616b; }
    #theme-usa .assignment-wrap .wrap__toggle.active {
      background: #0071bc; }
    #theme-usa .assignment-wrap .wrap__toggle:hover {
      background: #205493; }

#theme-usa .assignment a {
  color: #212121; }

#theme-usa .assignment .card {
  border-color: #aeb0b5;
  box-shadow: 0 0.25rem 0.7rem 0 #f1f1f1; }
  #theme-usa .assignment .card:hover, #theme-usa .assignment .card:focus {
    border-color: #0071bc; }
  #theme-usa .assignment .card:hover .assignment__name, #theme-usa .assignment .card:focus .assignment__name {
    color: #0071bc; }

#theme-usa .assignment__nav li:hover, #theme-usa .assignment__nav li:focus {
  background-color: #205493;
  border-color: #205493; }

#theme-usa .assignment__nav li + li {
  border-color: #aeb0b5; }

#theme-usa .assignment__nav a::after {
  color: #212121; }

#theme-usa .assignment__nav a:hover {
  color: #ffffff; }
  #theme-usa .assignment__nav a:hover::after {
    color: #ffffff; }

#theme-usa .assignment__nav .active {
  background-color: #0071bc; }

#theme-usa .assignment__header {
  background-color: #f1f1f1; }

#theme-usa .assignment__tools .tools__btn {
  background: #5b616b; }
  #theme-usa .assignment__tools .tools__btn.active {
    background: #0071bc; }
  #theme-usa .assignment__tools .tools__btn:hover {
    background: #205493; }

#theme-usa .assignment #synctv g path {
  fill: #0071bc; }

#theme-usa .bookshelf {
  color: #212121 !important;
  border-color: #5b616b; }
  #theme-usa .bookshelf:hover, #theme-usa .bookshelf:focus {
    color: #0071bc !important;
    border-color: #0071bc; }

#theme-usa .btn {
  background-color: #0071bc;
  background-image: none; }
  #theme-usa .btn:hover, #theme-usa .btn:focus {
    background: #112e51; }
  #theme-usa .btn--plain {
    background-color: transparent;
    border-color: #5b616b;
    color: #212121 !important; }
    #theme-usa .btn--plain:hover, #theme-usa .btn--plain:focus {
      background-color: transparent;
      border-color: #0071bc;
      color: #0071bc !important; }
  #theme-usa .btn--green, #theme-usa .btn--solid-orange {
    background: #0071bc; }
  #theme-usa .btn--solid-white {
    background-color: #ffffff;
    border-color: #5b616b;
    color: #0071bc !important; }
    #theme-usa .btn--solid-white:hover, #theme-usa .btn--solid-white:focus {
      background-color: #ffffff;
      border-color: #112e51;
      color: #112e51 !important; }
  #theme-usa .btn--plain-primary {
    background-color: transparent;
    border-color: #205493;
    color: #212121 !important; }
    #theme-usa .btn--plain-primary:hover, #theme-usa .btn--plain-primary:focus {
      background-color: transparent; }
  #theme-usa .btn--plain-secondary {
    background-color: transparent;
    border-color: #e31c3d;
    color: #212121 !important; }
    #theme-usa .btn--plain-secondary:hover, #theme-usa .btn--plain-secondary:focus {
      background-color: transparent; }
  #theme-usa .btn::after, #theme-usa .btn[disabled] {
    opacity: .75; }

#theme-usa [color-theme='blast'] {
  /* Text Color */
  /* Background Color */ }
  #theme-usa [color-theme='blast'] .apply-text-color,
  #theme-usa [color-theme='blast'] .assignment__meta li:before {
    color: #4c2c92; }
  #theme-usa [color-theme='blast'] .apply-bg-color {
    background-color: #4c2c92; }
  #theme-usa [color-theme='blast'] .apply-border-color {
    border-color: #4c2c92; }

#theme-usa .card-listings--review-mode [color-theme='blast'].card:after {
  background-color: #4c2c92; }

#theme-usa [color-theme='synctv'] {
  /* Text Color */
  /* Background Color */ }
  #theme-usa [color-theme='synctv'] .apply-text-color,
  #theme-usa [color-theme='synctv'] .assignment__meta li:before {
    color: #2e8540; }
  #theme-usa [color-theme='synctv'] .apply-bg-color {
    background-color: #2e8540; }
  #theme-usa [color-theme='synctv'] .apply-border-color {
    border-color: #2e8540; }

#theme-usa .card-listings--review-mode [color-theme='synctv'].card:after {
  background-color: #2e8540; }

#theme-usa [color-theme='reading'] {
  /* Text Color */
  /* Background Color */ }
  #theme-usa [color-theme='reading'] .apply-text-color,
  #theme-usa [color-theme='reading'] .assignment__meta li:before {
    color: #0071bc; }
  #theme-usa [color-theme='reading'] .apply-bg-color {
    background-color: #0071bc; }
  #theme-usa [color-theme='reading'] .apply-border-color {
    border-color: #0071bc; }

#theme-usa .card-listings--review-mode [color-theme='reading'].card:after {
  background-color: #0071bc; }

#theme-usa [color-theme='writing'] {
  /* Text Color */
  /* Background Color */ }
  #theme-usa [color-theme='writing'] .apply-text-color,
  #theme-usa [color-theme='writing'] .assignment__meta li:before {
    color: #e31c3d; }
  #theme-usa [color-theme='writing'] .apply-bg-color {
    background-color: #e31c3d; }
  #theme-usa [color-theme='writing'] .apply-border-color {
    border-color: #e31c3d; }

#theme-usa .card-listings--review-mode [color-theme='writing'].card:after {
  background-color: #e31c3d; }

#theme-usa [color-theme='skill'] {
  /* Text Color */
  /* Background Color */ }
  #theme-usa [color-theme='skill'] .apply-text-color,
  #theme-usa [color-theme='skill'] .assignment__meta li:before {
    color: #fdb81e; }
  #theme-usa [color-theme='skill'] .apply-bg-color {
    background-color: #fdb81e; }
  #theme-usa [color-theme='skill'] .apply-border-color {
    border-color: #fdb81e; }

#theme-usa .card-listings--review-mode [color-theme='skill'].card:after {
  background-color: #fdb81e; }

#theme-usa .data-table .table__head {
  border-color: #aeb0b5; }

#theme-usa .data-table .table__search input {
  background: #f1f1f1; }
  #theme-usa .data-table .table__search input:hover, #theme-usa .data-table .table__search input:focus {
    border-color: #0071bc; }

#theme-usa .data-table .table__actions .icon-gear {
  color: #5b616b; }
  #theme-usa .data-table .table__actions .icon-gear:hover, #theme-usa .data-table .table__actions .icon-gear:focus {
    color: #0071bc; }

#theme-usa .data-table th,
#theme-usa .data-table td {
  color: #212121; }

#theme-usa .data-table td {
  border-color: #aeb0b5; }

#theme-usa .data-table .icon-lock {
  color: #5b616b !important; }

#theme-usa .data-table .icon-ok-circled {
  color: #2e8540 !important; }

#theme-usa .data-table .droppable-overlay li:hover, #theme-usa .data-table .droppable-overlay li:focus {
  color: #0071bc; }

#theme-usa .droppable-overlay {
  border-color: #aeb0b5; }
  #theme-usa .droppable-overlay::before {
    border-color: #aeb0b5; }
  #theme-usa .droppable-overlay li:hover {
    background: #f1f1f1; }
  #theme-usa .droppable-overlay li a {
    color: #212121; }
    #theme-usa .droppable-overlay li a:hover {
      color: #0071bc; }

#theme-usa .file-list a {
  color: #212121;
  border-color: #5b616b; }
  #theme-usa .file-list a:hover, #theme-usa .file-list a:focus {
    color: #0071bc;
    border-color: #0071bc; }
    #theme-usa .file-list a:hover .file__icon, #theme-usa .file-list a:focus .file__icon {
      color: #0071bc; }

#theme-usa .file-list .file__icon {
  color: #0071bc; }
  #theme-usa .file-list .file__icon--right {
    color: #5b616b; }

#theme-usa .file-list .file__name {
  color: #0071bc; }

#theme-usa .form__checkbox label, #theme-usa .form__radio label {
  color: #212121; }
  #theme-usa .form__checkbox label:focus, #theme-usa .form__checkbox label:hover, #theme-usa .form__radio label:focus, #theme-usa .form__radio label:hover {
    color: #0071bc; }
    #theme-usa .form__checkbox label:focus::before, #theme-usa .form__checkbox label:hover::before, #theme-usa .form__radio label:focus::before, #theme-usa .form__radio label:hover::before {
      background-color: #2e8540;
      border-color: #0071bc; }

#theme-usa .form__checkbox input:checked + label::before, #theme-usa .form__radio input:checked + label::before {
  color: #212121; }

#theme-usa .form__radio input:checked + label::before {
  background-color: #2e8540; }

#theme-usa .form__radio input:checked + label:focus::before, #theme-usa .form__radio input:checked + label:hover::before {
  border-color: #0071bc; }

#theme-usa [class*='headline'] i[class*='icon-'] {
  color: #0071bc;
  opacity: 1; }

#theme-usa .headline--hr, #theme-usa .headline--short-hr {
  border-color: #aeb0b5; }

#theme-usa .headline--strikethrough::before {
  background: -webkit-linear-gradient( left , #f1f1f1 0, #aeb0b5 25%, #aeb0b5 75%, #f1f1f1 100%);
  background: linear-gradient(to right, #f1f1f1 0, #aeb0b5 25%, #aeb0b5 75%, #f1f1f1 100%); }

#theme-usa .home-features .features__content .content__ideas .ideas__list:hover .content__title, #theme-usa .home-features .features__content .content__ideas .ideas__list:focus .content__title {
  color: #112e51; }

#theme-usa .home-features .features__content .content__title {
  color: #0071bc; }

#theme-usa .home-features .features__content .content__prehead {
  color: #5b616b; }

#theme-usa .home-features .features__content .content__headline i.icon-nblasts {
  color: #4c2c92; }

#theme-usa .home-features .features__content .content__headline i.icon-nideas {
  color: #2e8540; }

#theme-usa .home-features .features__content .content__headline i.icon-ngettingstarted {
  color: #fdb81e; }

#theme-usa .home-masthead .masthead__headline mark {
  color: #0071bc; }

#theme-usa .hr {
  background: #aeb0b5; }

#theme-usa .inline-state-nav {
  border-color: #aeb0b5; }
  #theme-usa .inline-state-nav .active {
    border-color: #0071bc; }

#theme-usa .input__text input {
  color: #212121;
  border-color: #5b616b; }
  #theme-usa .input__text input::placeholder {
    color: #212121; }
  #theme-usa .input__text input:hover, #theme-usa .input__text input:focus {
    border-color: #0071bc; }
    #theme-usa .input__text input:hover::placeholder, #theme-usa .input__text input:focus::placeholder {
      color: #0071bc; }
  #theme-usa .input__text input[disabled] {
    opacity: .75; }
    #theme-usa .input__text input[disabled]:hover, #theme-usa .input__text input[disabled]:focus {
      border-color: #5b616b; }

#theme-usa .input__text label {
  color: #212121; }

#theme-usa .input__text[class*='icon']::before {
  color: #212121; }

#theme-usa .input__switch .switch__toggle {
  border-color: #5b616b;
  background-color: #5b616b;
  box-shadow: none; }

#theme-usa .input__switch :checked + .switch__toggle {
  border-color: #2e8540;
  box-shadow: inset 0 0 0 13px #2e8540; }
  #theme-usa .input__switch :checked + .switch__toggle:after {
    border-color: #2e8540; }

#theme-usa .link-list {
  color: #0071bc; }

#theme-usa .multitool__header.header--hr {
  border-color: #aeb0b5; }

#theme-usa .multitool .para {
  color: #0071bc; }

#theme-usa .ngdialog-close:hover::before {
  color: #e31c3d; }

#theme-usa .ngdialog-close::before {
  color: #212121; }

#theme-usa .page-header {
  background: #f1f1f1;
  border-color: #aeb0b5; }
  #theme-usa .page-header .header__details .details__section th {
    color: #323a45; }

#theme-usa .pagination a {
  color: #ffffff;
  background-color: #5b616b; }
  #theme-usa .pagination a:hover, #theme-usa .pagination a:focus {
    color: #ffffff;
    background-color: #205493; }

#theme-usa .pagination .active a {
  background-color: #0071bc; }
  #theme-usa .pagination .active a:hover, #theme-usa .pagination .active a:focus {
    background-color: #205493; }
  #theme-usa .pagination .active a::after {
    border-top-color: #0071bc; }
  #theme-usa .pagination .active a:hover::after, #theme-usa .pagination .active a:focus::after {
    border-top-color: #205493; }

#theme-usa .rating--blocks .active::before {
  background-color: #2e8540; }

#theme-usa .rating--blocks .active:focus::before, #theme-usa .rating--blocks .active:hover::before {
  border-color: #0071bc; }

#theme-usa .rating--blocks .active.zero::before {
  background: #5b616b;
  border-color: #5b616b; }

#theme-usa .rating--blocks .active.zero:focus::before, #theme-usa .rating--blocks .active.zero:hover::before {
  background: #5b616b;
  border-color: #0071bc;
  background-clip: content-box; }

#theme-usa [read-only] .rating--blocks {
  pointer-events: none; }

#theme-usa .primary-nav a {
  color: #212121; }
  #theme-usa .primary-nav a::after {
    height: 0;
    width: 0;
    border-bottom: 1rem solid #112e51;
    border-left: 1rem solid transparent;
    border-right: 1rem solid transparent; }

#theme-usa .primary-nav .active,
#theme-usa .primary-nav .active > a {
  color: #0071bc; }
  #theme-usa .primary-nav .active:hover,
  #theme-usa .primary-nav .active > a:hover {
    color: #112e51; }

#theme-usa .secondary-nav a {
  color: #212121; }
  #theme-usa .secondary-nav a::before {
    color: #112e51; }
  #theme-usa .secondary-nav a:hover::before {
    color: #0071bc; }

#theme-usa .primary-nav a:hover, #theme-usa .secondary-nav a:hover {
  color: #0071bc; }

#theme-usa .droppable-secondary-nav .secondary__alert, #theme-usa .overlay-nav.navOpen .secondary__alert {
  color: #ffffff; }
  #theme-usa .droppable-secondary-nav .secondary__alert::before, #theme-usa .overlay-nav.navOpen .secondary__alert::before {
    background: #0071bc; }
  #theme-usa .droppable-secondary-nav .secondary__alert:hover, #theme-usa .droppable-secondary-nav .secondary__alert:focus, #theme-usa .overlay-nav.navOpen .secondary__alert:hover, #theme-usa .overlay-nav.navOpen .secondary__alert:focus {
    color: #ffffff; }
    #theme-usa .droppable-secondary-nav .secondary__alert:hover::before, #theme-usa .droppable-secondary-nav .secondary__alert:focus::before, #theme-usa .overlay-nav.navOpen .secondary__alert:hover::before, #theme-usa .overlay-nav.navOpen .secondary__alert:focus::before {
      background: #112e51; }

#theme-usa .search-bar {
  background: #f1f1f1;
  border-color: #aeb0b5; }
  #theme-usa .search-bar .search__upper .input__text[class*='icon']::before {
    color: #212121; }
  #theme-usa .search-bar .search__upper .input__text input {
    border-color: #5b616b; }
    #theme-usa .search-bar .search__upper .input__text input:hover, #theme-usa .search-bar .search__upper .input__text input:focus {
      border-color: #0071bc; }
      #theme-usa .search-bar .search__upper .input__text input:hover::placeholder, #theme-usa .search-bar .search__upper .input__text input:focus::placeholder {
        color: #0071bc; }
    #theme-usa .search-bar .search__upper .input__text input::placeholder {
      color: #212121; }
  #theme-usa .search-bar .search__upper .input__text .selectize-input {
    border-color: #5b616b; }
    #theme-usa .search-bar .search__upper .input__text .selectize-input:hover, #theme-usa .search-bar .search__upper .input__text .selectize-input:focus {
      border-color: #0071bc; }
      #theme-usa .search-bar .search__upper .input__text .selectize-input:hover input::placeholder, #theme-usa .search-bar .search__upper .input__text .selectize-input:focus input::placeholder {
        color: #0071bc; }
  #theme-usa .search-bar .search__middle .middle__tags::before {
    color: #212121; }
  #theme-usa .search-bar .search__middle .middle__tags .tags__explore {
    color: #212121; }
    #theme-usa .search-bar .search__middle .middle__tags .tags__explore:hover {
      color: #0071bc; }
    #theme-usa .search-bar .search__middle .middle__tags .tags__explore::before {
      opacity: 1; }
  #theme-usa .search-bar .search__lower strong {
    color: #0071bc; }
  #theme-usa .search-bar .search__check-buttons label {
    border-color: #212121; }
    #theme-usa .search-bar .search__check-buttons label:hover, #theme-usa .search-bar .search__check-buttons label:focus {
      color: #0071bc;
      border-color: #0071bc; }
  #theme-usa .search-bar rzslider .rz-bar {
    background: #d6d7d9; }
    #theme-usa .search-bar rzslider .rz-bar.rz-selection {
      background: #0071bc; }
  #theme-usa .search-bar rzslider .rz-pointer {
    background: #0071bc; }
    #theme-usa .search-bar rzslider .rz-pointer:hover, #theme-usa .search-bar rzslider .rz-pointer:focus {
      background: #112e51; }
  #theme-usa .search-bar rzslider .rz-bubble.rz-limit {
    color: #212121; }

#theme-usa .selectize-control.single #theme-usa .selectize-input, #theme-usa .selectize-input, #theme-usa .selectize-input {
  border-color: #5b616b; }
  #theme-usa .selectize-control.single #theme-usa .selectize-input:hover, #theme-usa .selectize-control.single #theme-usa .selectize-input:focus, #theme-usa .selectize-control.single #theme-usa .selectize-input.focus, #theme-usa .selectize-input:hover, #theme-usa .selectize-input:focus, #theme-usa .selectize-input.focus, #theme-usa .selectize-input:hover, #theme-usa .selectize-input:focus, #theme-usa .selectize-input.focus {
    color: #0071bc;
    border-color: #0071bc; }
  #theme-usa .selectize-control.single #theme-usa .selectize-input::after, #theme-usa .selectize-input::after, #theme-usa .selectize-input::after {
    opacity: .75; }
  #theme-usa .selectize-control.single #theme-usa .selectize-input[disabled]:hover, #theme-usa .selectize-control.single #theme-usa .selectize-input[disabled]:focus, #theme-usa .selectize-control.single #theme-usa .selectize-input[disabled].focus, #theme-usa .selectize-input[disabled]:hover, #theme-usa .selectize-input[disabled]:focus, #theme-usa .selectize-input[disabled].focus, #theme-usa .selectize-input[disabled]:hover, #theme-usa .selectize-input[disabled]:focus, #theme-usa .selectize-input[disabled].focus {
    color: #212121 !important; }

#theme-usa .selectize-dropdown, #theme-usa .selectize-dropdown.single {
  border-color: #5b616b;
  box-shadow: 0 1px 3px 0 rgba(91, 97, 107, 0.1); }

#theme-usa .selectize-control.multi .selectize-input [data-value], #theme-usa .selectize-control.multi .selectize-input [data-value].active {
  background: #0071bc;
  border-color: #0071bc; }

#theme-usa .selectize-control.multi .selectize-input .remove {
  color: #ffffff; }

#theme-usa .sidebar .sidebar__nav {
  border-color: #aeb0b5; }
  #theme-usa .sidebar .sidebar__nav li:hover, #theme-usa .sidebar .sidebar__nav li:focus {
    background: #f1f1f1; }
  #theme-usa .sidebar .sidebar__nav li + li {
    border-color: #aeb0b5; }
  #theme-usa .sidebar .sidebar__nav .active {
    background: #f1f1f1; }
    #theme-usa .sidebar .sidebar__nav .active:hover {
      background: #aeb0b5; }

#theme-usa .spotlight {
  background: #f1f1f1; }

#theme-usa .ss-annotation {
  border-color: #aeb0b5; }
  #theme-usa .ss-annotation .annotation__actions .actions__all .droppable-overlay li {
    background-color: transparent; }
  #theme-usa .ss-annotation .annotation__actions .actions__swatch::after {
    color: #212121; }
  #theme-usa .ss-annotation .annotation__note textarea {
    border-color: #aeb0b5; }
    #theme-usa .ss-annotation .annotation__note textarea::placeholder {
      color: #212121; }
    #theme-usa .ss-annotation .annotation__note textarea:hover::placeholder, #theme-usa .ss-annotation .annotation__note textarea:focus::placeholder {
      color: #0071bc; }
  #theme-usa .ss-annotation button {
    color: #0071bc; }
    #theme-usa .ss-annotation button:hover, #theme-usa .ss-annotation button:focus {
      color: #112e51; }
    #theme-usa .ss-annotation button.icon-cancel {
      color: #212121; }
      #theme-usa .ss-annotation button.icon-cancel:hover, #theme-usa .ss-annotation button.icon-cancel:focus {
        color: #e31c3d; }

#theme-usa .ss-audio-player {
  color: #212121; }
  #theme-usa .ss-audio-player .audio__btn.icon-volume {
    color: #0071bc; }
    #theme-usa .ss-audio-player .audio__btn.icon-volume:hover {
      color: #112e51; }
  #theme-usa .ss-audio-player .audio__btn.active {
    color: #0071bc; }
  #theme-usa .ss-audio-player .audio__btn:hover {
    color: #0071bc; }
  #theme-usa .ss-audio-player rzslider .rz-pointer {
    background: #0071bc; }
    #theme-usa .ss-audio-player rzslider .rz-pointer:hover, #theme-usa .ss-audio-player rzslider .rz-pointer:focus {
      background: #112e51; }
  #theme-usa .ss-audio-player rzslider .rz-bar {
    background: #aeb0b5; }
    #theme-usa .ss-audio-player rzslider .rz-bar.rz-selection {
      background: #0071bc; }

#theme-usa .ss-carousel.library-featured .flickity-prev-next-button:hover .arrow, #theme-usa .ss-carousel.library-featured .flickity-prev-next-button:focus .arrow, #theme-usa .ss-carousel.library-slideshow .flickity-prev-next-button:hover .arrow, #theme-usa .ss-carousel.library-slideshow .flickity-prev-next-button:focus .arrow {
  fill: #0071bc; }

#theme-usa .ss-carousel.library-featured .flickity-page-dots .dot, #theme-usa .ss-carousel.library-slideshow .flickity-page-dots .dot {
  opacity: 1; }
  #theme-usa .ss-carousel.library-featured .flickity-page-dots .dot.is-selected, #theme-usa .ss-carousel.library-slideshow .flickity-page-dots .dot.is-selected {
    background: #0071bc; }
    #theme-usa .ss-carousel.library-featured .flickity-page-dots .dot.is-selected:hover, #theme-usa .ss-carousel.library-slideshow .flickity-page-dots .dot.is-selected:hover {
      background: #112e51; }
  #theme-usa .ss-carousel.library-featured .flickity-page-dots .dot:hover, #theme-usa .ss-carousel.library-slideshow .flickity-page-dots .dot:hover {
    background: #0071bc; }

#theme-usa .ss-carousel.library-featured .carousel__slide:hover .lower__name, #theme-usa .ss-carousel.library-slideshow .carousel__slide:hover .lower__name {
  color: #112e51; }

#theme-usa .ss-carousel.library-featured .slideshow__body .body__name, #theme-usa .ss-carousel.library-featured .slideshow__body .body__subhead, #theme-usa .ss-carousel.library-slideshow .slideshow__body .body__name, #theme-usa .ss-carousel.library-slideshow .slideshow__body .body__subhead {
  color: #ffffff; }

#theme-usa .ss-carousel.library-featured .slideshow__body .body__byline, #theme-usa .ss-carousel.library-slideshow .slideshow__body .body__byline {
  color: #ffffff; }
  #theme-usa .ss-carousel.library-featured .slideshow__body .body__byline::after, #theme-usa .ss-carousel.library-slideshow .slideshow__body .body__byline::after {
    background: #aeb0b5; }

#theme-usa .ss-carousel.library-featured .slideshow__lower .lower__name, #theme-usa .ss-carousel.library-slideshow .slideshow__lower .lower__name {
  color: #0071bc; }

#theme-usa .ss-carousel.library-featured .slideshow__lower .lower__byline, #theme-usa .ss-carousel.library-slideshow .slideshow__lower .lower__byline {
  color: #212121;
  opacity: 1; }

#theme-usa .ss-carousel.library-featured .slideshow__expand, #theme-usa .ss-carousel.library-slideshow .slideshow__expand {
  border-color: #aeb0b5; }
  #theme-usa .ss-carousel.library-featured .slideshow__expand::before, #theme-usa .ss-carousel.library-slideshow .slideshow__expand::before {
    color: #0071bc; }

#theme-usa .ss-carousel.library-featured .flickity-prev-next-button .arrow {
  fill: #f1f1f1; }

#theme-usa .ss-carousel.library-featured .flickity-page-dots .dot {
  background: #f1f1f1; }

#theme-usa .ss-carousel.library-featured .btn {
  background: #e31c3d; }
  #theme-usa .ss-carousel.library-featured .btn:hover {
    background: #981b1e; }

#theme-usa .ss-carousel.library-slideshow .flickity-prev-next-button .arrow {
  fill: #323a45; }

#theme-usa .ss-carousel.library-slideshow .flickity-page-dots .dot {
  background: #323a45; }

#theme-usa .ss-carousel.library-slideshow .carousel__preview .preview__close:hover::before {
  color: #e31c3d; }

#theme-usa .ss-carousel.library-slideshow .carousel__preview .preview__close::before {
  color: #212121; }

#theme-usa .ss-carousel.library-slideshow .carousel__preview .preview__view-btn {
  border-color: #212121;
  color: #212121 !important; }
  #theme-usa .ss-carousel.library-slideshow .carousel__preview .preview__view-btn:hover, #theme-usa .ss-carousel.library-slideshow .carousel__preview .preview__view-btn:focus {
    border-color: #0071bc;
    color: #0071bc !important; }

#theme-usa .ss-form .form__section, #theme-usa .ss-form .form__submit {
  border-color: #aeb0b5; }

#theme-usa .ss-form .form__submit button[type='submit'] {
  background-color: #e31c3d; }
  #theme-usa .ss-form .form__submit button[type='submit']:hover, #theme-usa .ss-form .form__submit button[type='submit']:focus {
    background-color: #981b1e; }

#theme-usa .ss-loader span {
  -webkit-animation-name: loaderZoomUsa;
  -moz-animation-name: loaderZoomUsa;
  animation-name: loaderZoomUsa;
  background-color: #0071bc; }

@keyframes loaderZoomUsa {
  30% {
    background-color: #aeb0b5; }
  80% {
    background-color: #aeb0b5; }
  100% {
    background-color: #0071bc; } }

#theme-usa .ss-searchable__end p {
  color: #212121; }

#theme-usa .ss-tag-list li {
  color: #212121;
  border-color: #5b616b; }
  #theme-usa .ss-tag-list li.active:hover {
    color: #0071bc;
    border-color: #0071bc; }

#theme-usa .ss-tag-picker .picker__list li {
  color: #212121;
  border-color: #212121; }
  #theme-usa .ss-tag-picker .picker__list li:hover {
    color: #0071bc;
    border-color: #0071bc; }
  #theme-usa .ss-tag-picker .picker__list li:hover .remove {
    color: #e31c3d; }
  #theme-usa .ss-tag-picker .picker__list li .remove {
    color: #212121; }
  #theme-usa .ss-tag-picker .picker__list li.active {
    color: #0071bc; }
    #theme-usa .ss-tag-picker .picker__list li.active:hover {
      color: #e31c3d;
      border-color: #e31c3d; }

#theme-usa .ss-tag-picker .picker__lower {
  border-color: #aeb0b5; }

#theme-usa .subnav {
  background: #112e51; }
  #theme-usa .subnav a {
    color: #ffffff; }
    #theme-usa .subnav a:hover, #theme-usa .subnav a:focus {
      color: #dce4ef; }

#theme-usa .te-wrap {
  border-color: #0071bc; }
  #theme-usa .te-wrap .wrap__toggle {
    background: #0071bc; }

#theme-usa .toggle-view button i {
  color: #212121 !important; }

#theme-usa .toggle-view button.active i, #theme-usa .toggle-view button:hover i {
  color: #0071bc !important; }

#theme-usa body {
  color: #212121; }

#theme-usa h1, #theme-usa h2, #theme-usa h3, #theme-usa h4, #theme-usa h5, #theme-usa h6 {
  color: #212121; }

#theme-usa a {
  -webkit-transition: all 0.15s ease-in-out;
  -moz-transition: all 0.15s ease-in-out;
  transition: all 0.15s ease-in-out;
  color: #0071bc; }
  #theme-usa a:hover, #theme-usa a:focus {
    color: #112e51; }

#theme-usa .accent, #theme-usa .disclaimer, #theme-usa .text-light {
  color: #5b616b; }

#theme-usa .extq__panel {
  background-color: #f1f1f1; }

#theme-usa .extq__chart th, #theme-usa .extq__chart td {
  border-color: #aeb0b5; }

#theme-usa .extq__chart td.invalid {
  background: rgba(227, 28, 61, 0.1); }

#theme-usa .extq__chart td.warning {
  background: rgba(253, 184, 30, 0.1); }

#theme-usa .extq__chart .ui-droppable.active {
  background: rgba(0, 113, 188, 0.1); }

#theme-usa .extq__chart .ui-droppable.hover {
  background: rgba(17, 46, 81, 0.5); }

#theme-usa .extq__draggables li,
#theme-usa .extq__draggables li + li {
  border-color: #0071bc; }
  #theme-usa .extq__draggables li:hover, #theme-usa .extq__draggables li:focus,
  #theme-usa .extq__draggables li + li:hover,
  #theme-usa .extq__draggables li + li:focus {
    color: #0071bc; }

#theme-usa .help-center__element--completed {
  color: #205493; }

#theme-usa .help-center__element--halfway {
  color: #e31c3d; }

#theme-usa .help-center .guide-list__credit-counter {
  color: #212121; }

#theme-usa .v-tree .v-tree__item .v-tree__item-header .v-tree__item-expander::before {
  background: #e31c3d;
  color: #ffffff; }

#theme-usa .v-tree .v-tree__item.v-tree__item--selected > .v-tree__item-header {
  background-color: #f1f1f1;
  color: #e31c3d; }